[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54839.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y2017_CORGL  RecName: Full=Uncharacterized membrane protein Cgl2017/cg2211;         Short=P20;

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   9->69 PF10939 * DUF2631 9e-18 62.3 %
:HMM:PFM   6->68 PF10939 * DUF2631 1.1e-31 50.8 63/65  
:BLT:SWISS 1->147 Y2017_CORGL 1e-84 99.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54839.1 GT:GENE BAF54839.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2050333..2050776 GB:FROM 2050333 GB:TO 2050776 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54839.1 LENGTH 147 SQ:AASEQ MAGSSHTIEPEIYRGVSTLDEPSAAWGWHGLKRNTIQLAGWISVLFMLGYNFGNHKGHVETIWLLVITALLVIGLLIHLFEPKLSQVRTITSRNKPVGHVEPDWTYDQATLTGTWGNLTDSQLRSVNIEPSRVAHLRAADSAKELDS GT:EXON 1|1-147:0| SW:ID Y2017_CORGL SW:DE RecName: Full=Uncharacterized membrane protein Cgl2017/cg2211; Short=P20; SW:GN OrderedLocusNames=Cgl2017, cg2211; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->147|Y2017_CORGL|1e-84|99.3|147/147| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 34->56| TM:REGION 64->86| RP:PFM:NREP 1 RP:PFM:REP 9->69|PF10939|9e-18|62.3|61/64|DUF2631| HM:PFM:NREP 1 HM:PFM:REP 6->68|PF10939|1.1e-31|50.8|63/65|DUF2631| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -----111111111------------------------11------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,140-148| PSIPRED ccccccccccHHHccccHHHcccHHHccccccccEEEEEHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccEEEEEEcccccccHHHHHEEcccHHHHHHHHHcHHHHHHcc //