[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54844.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  762/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
:297 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   46->288 PF01148 * CTP_transf_1 6e-24 34.3 %
:HMM:PFM   28->289 PF01148 * CTP_transf_1 1.6e-53 28.3 251/259  
:BLT:SWISS 9->291 CDSA_MYCLE 1e-66 47.7 %
:PROS 249->275|PS01315|CDS
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54844.1 GT:GENE BAF54844.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2055243..2056136) GB:FROM 2055243 GB:TO 2056136 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54844.1 LENGTH 297 SQ:AASEQ MNEPEQHHRSMRMPKPKNNAGRDLKAAIAVGIGLGVLVLLGIVLSPWGWYILVAGFMAAATWEVGSRLKEGGYHLPLPIMIIGGQAIIWLSWPFGTMGILASFVATVLVLMYFRIFYNGTEKEARNYLRDTSVGIFVLTWIPLFGSFAAMLSLMQNNSIPGTYFILTFMLCVIASDVGGYIAGVFFGSHPMAPLVSPKKSWEGFAGSIVLGSVTGALSVHFLLDHHWWMGVILGCALVVCATLGDLVESQFKRDLGIKDMSNLLPGHGGLMDRLDGMLPAAMVTWLILSVISSSYPS GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 9->291|CDSA_MYCLE|1e-66|47.7|279/312| PROS 249->275|PS01315|CDS|PDOC01019| TM:NTM 7 TM:REGION 32->54| TM:REGION 84->106| TM:REGION 131->153| TM:REGION 163->185| TM:REGION 202->224| TM:REGION 228->250| TM:REGION 275->297| SEG 26->44|aaiavgiglgvlvllgivl| RP:PFM:NREP 1 RP:PFM:REP 46->288|PF01148|6e-24|34.3|236/262|CTP_transf_1| HM:PFM:NREP 1 HM:PFM:REP 28->289|PF01148|1.6e-53|28.3|251/259|CTP_transf_1| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF01148|IPR000374| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF01148|IPR000374| OP:NHOMO 904 OP:NHOMOORG 789 OP:PATTERN -------------------------------------------------------------------- 1-1-111111111111111-11111111111111111111111111111111111211111111111111111111111111111111222111111--12111111111--11-1--------1111111111111111-111--1111112111111111-1-11111111111111111111-11111-111111111111111111111111111--11-1111111111111111111111111111111111111--1111111111111-111111111111-----------11111111111111111111111111-111111111111111111111111-1-1111111-1111--1111-113-11--111111111---11--111111111111-------1---112--111111111111112-211111-----------11111-111111---11111111111111111111111--111111-222222-----1111-----1221111111--1111--11112-1111111111111111-1-111111111111111111---21---111-1111121211111111-11111111-1111111111-11111111111111111111111111-12--1------11111112222222222-2222211222222222222111112221111111111111111111111111-1222222222221112111111111-11111111211111111121-11111111-1222212121111112111111111111-11122222--11122111111111111111-1111111-111111-11----1--11--1-----11------1111111111-11 --------------------------------------------------------1----------------------------------------------111--2------------------1-12---------------------------1-----------------1-1A111111----312253581 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-21,295-298| PSIPRED ccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccc //