[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54853.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y1859_CORGB  RecName: Full=UPF0102 protein cgR_1859;

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->106 3fovA PDBj 7e-07 39.8 %
:RPS:SCOP  12->105 2inbA1  c.52.1.32 * 6e-16 16.0 %
:HMM:SCOP  10->110 1hh1A_ c.52.1.18 * 1e-11 31.6 %
:RPS:PFM   12->100 PF02021 * UPF0102 1e-11 54.0 %
:HMM:PFM   19->100 PF02021 * UPF0102 2.8e-22 42.0 81/93  
:BLT:SWISS 1->122 Y1859_CORGB 4e-67 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54853.1 GT:GENE BAF54853.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2064558..2064926) GB:FROM 2064558 GB:TO 2064926 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54853.1 LENGTH 122 SQ:AASEQ MKTQKQYLGAFGEDVALQQYLDDQATLLDRNVRYSCGELDLIVRLASGVVVFVEVKTRRGSAFDSAAAVNNQKMLRMRRAAALWLEGKPYTPIRFDVVAIVLDPHTGRPGITVYEDVEHGAR GT:EXON 1|1-122:0| SW:ID Y1859_CORGB SW:DE RecName: Full=UPF0102 protein cgR_1859; SW:GN OrderedLocusNames=cgR_1859; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|Y1859_CORGB|4e-67|100.0|122/122| TM:NTM 1 TM:REGION 34->55| BL:PDB:NREP 1 BL:PDB:REP 14->106|3fovA|7e-07|39.8|83/101| RP:PFM:NREP 1 RP:PFM:REP 12->100|PF02021|1e-11|54.0|87/93|UPF0102| HM:PFM:NREP 1 HM:PFM:REP 19->100|PF02021|2.8e-22|42.0|81/93|UPF0102| RP:SCP:NREP 1 RP:SCP:REP 12->105|2inbA1|6e-16|16.0|94/128|c.52.1.32| HM:SCP:REP 10->110|1hh1A_|1e-11|31.6|98/0|c.52.1.18|1/1|Restriction endonuclease-like| OP:NHOMO 42 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- -----111111---1---------------------111111-11----11-----1---1------111-1---111------------------------------1----------------1---------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--1----11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------11---11-----------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 74.6 SQ:SECSTR #############HHHHHHHHHHTTEEEEEEEEETTEEEEEEEEHETTEEEEEEEEEcTccccEEcccccHHHHHHHHHHHHHHHHHcGTcEEEEE##EEEEcTTc################ DISOP:02AL 1-4,121-123| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEEcccEEEEEEEEEEcccccccHHHccHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccccccEEEEEcccccccc //