[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54861.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54861.1 GT:GENE BAF54861.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2071258..2071680 GB:FROM 2071258 GB:TO 2071680 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54861.1 LENGTH 140 SQ:AASEQ MTSPYPDPVSSPTATPTKRGAGCGKWAAILGSSFLIFMGLVTACGPDTVESEVPGPTVTQTVTQTTTATPATRTVTTTVEPTTEEPVQEEVEPAAVEVEEEPAPAPTNNVNAPQRAASIPEPAPAPAPAAAPYYKNCTAV GT:EXON 1|1-140:0| TM:NTM 1 TM:REGION 24->46| SEG 52->113|evpgptvtqtvtqtttatpatrtvtttveptteepvqeevepaaveveeepapaptnnvnap| SEG 116->132|aasipepapapapaaap| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,8-8,51-129| PSIPRED cccccccccccccccccccccccHHHHHHHcccHHHHHcccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccc //