[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54866.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->118 PF07187 * DUF1405 0.00044 23.4 77/164  
:HMM:PFM   114->132 PF07664 * FeoB_C 0.00085 21.1 19/54  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54866.1 GT:GENE BAF54866.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2073511..2073957) GB:FROM 2073511 GB:TO 2073957 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54866.1 LENGTH 148 SQ:AASEQ MVAWKARLSRVAPRIAALTWAAYAVTRVAAYASASPPQLQQVHEILPLWIPWTVVATLLILGGLVPPRAGQRSKSLARGMRQWGSVISTMTLGIWAVAFLLADASRGWVSAVNYFMLTAFAVLSGWIMSREVASVRAVQGGDAYAPMD GT:EXON 1|1-148:0| TM:NTM 4 TM:REGION 9->31| TM:REGION 44->66| TM:REGION 81->103| TM:REGION 108->130| SEG 21->35|aayavtrvaayasas| HM:PFM:NREP 2 HM:PFM:REP 37->118|PF07187|0.00044|23.4|77/164|DUF1405| HM:PFM:REP 114->132|PF07664|0.00085|21.1|19/54|FeoB_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,5-7,70-77,143-143,146-149| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //