[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54879.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->94 PF09599 * IpaC_SipC 0.00076 25.7 74/337  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54879.1 GT:GENE BAF54879.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2087246..2087650) GB:FROM 2087246 GB:TO 2087650 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54879.1 LENGTH 134 SQ:AASEQ MTTTPRKTTRKAAPKATGAEVVVKTDEQLEAEQSALEQEVAAETEGAGEKETPTFTIQLNGEDIEVEDRWDRPGKIPPISVMFSSDEMAAKMSTPIIVQLIGEDQLYNLIMLGLTQDEFVLVARAWMESRGLGK GT:EXON 1|1-134:0| SEG 2->17|tttprkttrkaapkat| SEG 27->54|eqleaeqsaleqevaaetegageketpt| HM:PFM:NREP 1 HM:PFM:REP 12->94|PF09599|0.00076|25.7|74/337|IpaC_SipC| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15,32-50,133-135| PSIPRED cccccccHHHHHcccccccEEEEEcHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccEEEEccccccccccccEEEEEEccHHHHHccccEEEEEEccccEEEEEEEEcccccEEEEEHHHHHHccccc //