[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54883.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   29->72 PF02887 * PK_C 0.00068 32.6 43/117  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54883.1 GT:GENE BAF54883.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2089068..2089400) GB:FROM 2089068 GB:TO 2089400 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54883.1 LENGTH 110 SQ:AASEQ MAEVIVVHGAAGGVDDDGYPIPGKADESHSVKSVQPLSLEEISEDDRQGVKDALRVWGNSGLKVSPGDHVTVRGFKYRVVKTAWDWSKNRRPANPRHRPGTVFDCVRGVG GT:EXON 1|1-110:0| SEG 2->18|aevivvhgaaggvdddg| HM:PFM:NREP 1 HM:PFM:REP 29->72|PF02887|0.00068|32.6|43/117|PK_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,110-111| PSIPRED ccEEEEEEccccccccccccccccccccEEEEEcccccHHHHHHccccccEEEEEEEEcccEEEccccEEEEEEEEEEEEEEEcccccccccccccccccEEEEEEEccc //