[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54887.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   56->120 PF04773 * FecR 0.00056 21.3 61/98  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54887.1 GT:GENE BAF54887.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2091240..2091614) GB:FROM 2091240 GB:TO 2091614 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54887.1 LENGTH 124 SQ:AASEQ MSNATYNGAISYDVSGTIPKFSLVKLNAAGKIELAAATGAVFGAVTEPGSLSEDPRVDGNDILAVSFGHVGVKIRTDDEIAAGDAVFAAASGKAAAEGTVQVGVAARDSKNGVVITVLNGLPRA GT:EXON 1|1-124:0| SEG 35->46|aaatgavfgavt| SEG 81->98|aagdavfaaasgkaaaeg| HM:PFM:NREP 1 HM:PFM:REP 56->120|PF04773|0.00056|21.3|61/98|FecR| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,123-125| PSIPRED ccccccccEEEEEEccccccEEEEEEccccEEEEEEEcccEEEEEccccccccccccccccEEEEEEccEEEEEEcccccccccEEEEEcccccccccEEEEEEEEccccccEEEEEEcccccc //