[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54892.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->99 2b39A PDBj 2e-04 27.0 %
:BLT:SWISS 26->99 CO3_BOVIN 7e-04 27.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54892.1 GT:GENE BAF54892.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2096850..2097167 GB:FROM 2096850 GB:TO 2097167 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54892.1 LENGTH 105 SQ:AASEQ MGIGRTYASNTFTWLKQNERDFVGFVKPLDIGVNQADASFFVLSNALFSKAQTNVFSVGIKITKGSIVLEMDPDQLGRVGLFREEADKPEDIELVPVSEVIFTRQ GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 26->99|CO3_BOVIN|7e-04|27.0|74/100| BL:PDB:NREP 1 BL:PDB:REP 26->99|2b39A|2e-04|27.0|74/1610| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 70.5 SQ:SECSTR #########################EEEcccEEEEEEEEEEEccccccEEEEEEEEcccEEEEEEEEEEEEcHHHHcccccEEEEEcccccccccTTcc###### DISOP:02AL 1-4| PSIPRED cccccEEcccEEEEEccccccEEEEEcccEEcccccccEEEEEEHHHHccccccEEEEEEEEEccEEEEEEcHHHcccEEEEEccccccccEEEEEHHHEEEEcc //