[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54895.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   72->145 1obbB PDBj 3e-04 35.4 %
:BLT:SWISS 17->77 ASD1_ARATH 4e-04 37.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54895.1 GT:GENE BAF54895.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2100496..2100936) GB:FROM 2100496 GB:TO 2100936 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54895.1 LENGTH 146 SQ:AASEQ MTDIIARAKELAKNGHTKGPWRASLFNGFRNDDGSSNFEGGIYPEDYGSPPIFLTSSGIDEHDAHVIAFAAEAVESLAEEKYVWSVQVLMSGRWIFMVTLNTGNSLEEAAKWFPTKKRAEYFASLWEPDTPARVVKRRVSPVIVDG GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 17->77|ASD1_ARATH|4e-04|37.7|61/678| BL:PDB:NREP 1 BL:PDB:REP 72->145|1obbB|3e-04|35.4|65/475| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 44.5 SQ:SECSTR #######################################################################HHHHHHTGGGEEEEEEEETTEEEEEEEEETTEEcHHHHHHHHHHHGGG######cccccT###TccTTcHHHHH# DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHccccccccHHHHHHccccccccccccccccHHHcccccEEEEcccccccccEEEEEHHHHHHHHHHcccEEEEEEEEcccEEEEEEEcccccHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHcccEEEcc //