[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54896.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->74 2qzyB PDBj 5e-04 47.1 %
:REPEAT 2|47->56|61->69

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54896.1 GT:GENE BAF54896.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2100933..2101172) GB:FROM 2100933 GB:TO 2101172 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54896.1 LENGTH 79 SQ:AASEQ MTTPKLRYTKPPSMTYHIDVWCDGPKCDMQRLEHDGDGWTCDICGPSWDDPEGDGMDASESWGDELDGLPLYDEEGNQQ GT:EXON 1|1-79:0| NREPEAT 1 REPEAT 2|47->56|61->69| BL:PDB:NREP 1 BL:PDB:REP 41->74|2qzyB|5e-04|47.1|34/597| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 34 STR:RPRED 43.0 SQ:SECSTR ########################################cTTccTTTTcTTcEEEEEEEEEEccccccccEEE##### DISOP:02AL 1-3,55-60,74-80| PSIPRED ccccccEEcccccEEEEEEEEEccccccHHHHHHcccccccccccccccccccccccccccccccccccEEEccccccc //