[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54902.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   120->141 PF08951 * EntA_Immun 0.00092 40.9 22/75  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54902.1 GT:GENE BAF54902.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2103341..2103787) GB:FROM 2103341 GB:TO 2103787 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54902.1 LENGTH 148 SQ:AASEQ MTEFFNIGKSLAGDRLPAITKENVEAWARVLPEICVLSKSSMQKVLTRWSREGTTQRMATPKDIRDALVAEKKAWQQSPQGRAWHREHQRRMEDLRDQQLRDGTFRELRYAGRQALEAPPKSNEKINSLIQQAYKKIENGKGVVHGDR GT:EXON 1|1-148:0| HM:PFM:NREP 1 HM:PFM:REP 120->141|PF08951|0.00092|40.9|22/75|EntA_Immun| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,75-94,115-123,143-143,145-149| PSIPRED ccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccc //