[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54911.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->47 PF05112 * Baculo_p47 0.00017 25.8 31/313  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54911.1 GT:GENE BAF54911.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2107124..2107291) GB:FROM 2107124 GB:TO 2107291 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54911.1 LENGTH 55 SQ:AASEQ MISTLLKTAKTALLKTRSWRGWKDREVQQIMLIVRNIDDLIRIYEVRSPVVNDRG GT:EXON 1|1-55:0| SEG 4->16|tllktaktallkt| HM:PFM:NREP 1 HM:PFM:REP 17->47|PF05112|0.00017|25.8|31/313|Baculo_p47| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,6-6,52-56| PSIPRED cHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccc //