[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54915.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->43 PF01527 * Transposase_8 0.001 25.7 35/76  
:BLT:SWISS 4->68 YVZC_BACSU 3e-04 27.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54915.1 GT:GENE BAF54915.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2110172..2110456) GB:FROM 2110172 GB:TO 2110456 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54915.1 LENGTH 94 SQ:AASEQ MKIIDTTYFKREWIEDQLDNFQSLSAFANKLGVLPSTASRWIEPGKEASPRAIGAVLNNFPVNFDDAFITVREEAVTQRIAFRAVSTKRQISAA GT:EXON 1|1-94:0| BL:SWS:NREP 1 BL:SWS:REP 4->68|YVZC_BACSU|3e-04|27.7|65/100| HM:PFM:NREP 1 HM:PFM:REP 9->43|PF01527|0.001|25.7|35/76|Transposase_8| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,90-90,92-95| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccHHHHHHHHHcccccccccEEEHHHHHHHHHHHHHHHcccHHHccc //