[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54920.1
DDBJ      :             hypothetical protein
Swiss-Prot:RL19_CORGB   RecName: Full=50S ribosomal protein L19;

Homologs  Archaea  0/68 : Bacteria  905/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->112 1vs6P PDBj 1e-27 50.5 %
:RPS:PDB   2->110 3bboR PDBj 6e-28 32.4 %
:RPS:SCOP  1->113 2j01T1  b.34.5.6 * 9e-36 45.1 %
:HMM:SCOP  1->114 2gyaN1 b.34.5.6 * 5.3e-42 60.5 %
:RPS:PFM   4->112 PF01245 * Ribosomal_L19 1e-28 62.4 %
:HMM:PFM   1->113 PF01245 * Ribosomal_L19 1.8e-51 58.4 113/113  
:BLT:SWISS 1->113 RL19_CORGB 2e-52 100.0 %
:PROS 85->100|PS01015|RIBOSOMAL_L19
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54920.1 GT:GENE BAF54920.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2113610..2113951) GB:FROM 2113610 GB:TO 2113951 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54920.1 LENGTH 113 SQ:AASEQ MNILDKIDAASLRDDVPAFRAGDTLDVHVKVIEGTTTRTQLFKGVVIRRQGGGIRETFTVRKVSFGIGVERTFPVHSPNIEKIEVVRRGDVRRAKLYYLRELRGKAARIKEKR GT:EXON 1|1-113:0| SW:ID RL19_CORGB SW:DE RecName: Full=50S ribosomal protein L19; SW:GN Name=rplS; OrderedLocusNames=cgR_1925; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->113|RL19_CORGB|2e-52|100.0|113/113| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 85->100|PS01015|RIBOSOMAL_L19|PDOC00778| SEG 44->55|gvvirrqgggir| BL:PDB:NREP 1 BL:PDB:REP 2->112|1vs6P|1e-27|50.5|111/114| RP:PDB:NREP 1 RP:PDB:REP 2->110|3bboR|6e-28|32.4|108/113| RP:PFM:NREP 1 RP:PFM:REP 4->112|PF01245|1e-28|62.4|109/112|Ribosomal_L19| HM:PFM:NREP 1 HM:PFM:REP 1->113|PF01245|1.8e-51|58.4|113/113|Ribosomal_L19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01245|IPR001857| GO:PFM GO:0005622|"GO:intracellular"|PF01245|IPR001857| GO:PFM GO:0005840|"GO:ribosome"|PF01245|IPR001857| GO:PFM GO:0006412|"GO:translation"|PF01245|IPR001857| RP:SCP:NREP 1 RP:SCP:REP 1->113|2j01T1|9e-36|45.1|113/137|b.34.5.6| HM:SCP:REP 1->114|2gyaN1|5.3e-42|60.5|114/0|b.34.5.6|1/1|Translation proteins SH3-like domain| OP:NHOMO 945 OP:NHOMOORG 920 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111-1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-11111111111111111-1111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------112E1221-1251-21------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 100.0 SQ:SECSTR cccTTHHHHTTccccccccccccccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccccccccccccccccccccccccTTcccccccc DISOP:02AL 107-107,112-114| PSIPRED ccHHHHHHHHHHHccccccccccEEEEEEEEEccccEEEEEEEEEEEEEcccccccEEEEEEcccccEEEEEEEcccccEEEEEEEEEcccHHHHHHHHHcccccEEEEEEcc //