[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54928.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  221/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
:400 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   55->397 PF00939 * Na_sulph_symp 5e-23 29.9 %
:HMM:PFM   16->257 PF00939 * Na_sulph_symp 4.2e-74 46.4 235/471  
:HMM:PFM   254->400 PF00939 * Na_sulph_symp 1.6e-39 40.8 147/471  
:BLT:SWISS 13->400 YFLS_BACSU 7e-99 55.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54928.1 GT:GENE BAF54928.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2121689..2122891) GB:FROM 2121689 GB:TO 2122891 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54928.1 LENGTH 400 SQ:AASEQ MANVWPVHRNDCGDFLKPMPMGAVTIIGMITAVLTGLVPLTAPSDDPGAVYGLIGFSNGTIWLIVMAFLISRGFIKTGLGRRIALFFVSKVGGKMLGVTYGLALADLVLAPAIPSATARGGVIMAPIMKSVALTYDSTPGPTRRRAGAFLALNVGQVNAITCAMFLTAMAGNPLIASLASQMDVNITWTNWAVGAIVPGLVALIVVPWVVYKIYPPELKDTPEVKTMASDELKQLGAFTYGEKVLSGTFVVLLLLWIAVLYMMATALSQYGFIAWISEVIASSLGGMNWVVALVVLVLIYFFSHYFFASATAHISAMYLAFLGAAIAIGAPPLMAALVLAYTSNLFSSLTQYSGGPSPTLFGLNYITVGEWWRTSAIAGAVSITIWLVIGGLWMNVIGLW GT:EXON 1|1-400:0| BL:SWS:NREP 1 BL:SWS:REP 13->400|YFLS_BACSU|7e-99|55.1|379/478| TM:NTM 9 TM:REGION 20->41| TM:REGION 50->72| TM:REGION 95->117| TM:REGION 152->174| TM:REGION 191->213| TM:REGION 244->266| TM:REGION 276->298| TM:REGION 315->337| TM:REGION 376->398| SEG 319->337|laflgaaiaigapplmaal| RP:PFM:NREP 1 RP:PFM:REP 55->397|PF00939|5e-23|29.9|341/459|Na_sulph_symp| HM:PFM:NREP 2 HM:PFM:REP 16->257|PF00939|4.2e-74|46.4|235/471|Na_sulph_symp| HM:PFM:REP 254->400|PF00939|1.6e-39|40.8|147/471|Na_sulph_symp| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00939|IPR001898| GO:PFM GO:0006814|"GO:sodium ion transport"|PF00939|IPR001898| GO:PFM GO:0016020|"GO:membrane"|PF00939|IPR001898| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00939|IPR001898| OP:NHOMO 442 OP:NHOMOORG 243 OP:PATTERN ----------------1-----------------------------------------------1--- --1--111111--1-----------------------1-----------11----1-------------------------1------------------11-------111111111111111---------------------------------------------------------------------1-----------------11-1---1--1-----------13222222222232212211-1-1--1-11-3311---111--------------------------------------------------1-1---------------1-------11----11------11--------------------11------2--1-----------------1------------------1---------------------------1-------------------------------------1111-------------------------1123-------1111--4----1------1111111------1-1------11---------------------1--1---2---1--111111----1----1--------------1----1---111------1-------4-123113333333333-334543333332322332113133--12322-1211122222222-12232--21111111-111-----------------111-21111111-1-----------11------1-1-----------------------------1-11-----------------------------------------------------------------------1- -------------------------------------------------------------------------------------------------------212---------------------1----------------------------------------------1-333n332335334-33------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,134-144| PSIPRED ccccccccccccccEEcccccHHHHHHHHHHHHHHcccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccHHEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //