[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54933.1
DDBJ      :             hypothetical protein
Swiss-Prot:TRMD_CORGL   RecName: Full=tRNA (guanine-N(1)-)-methyltransferase;         EC=2.1.1.31;AltName: Full=M1G-methyltransferase;AltName: Full=tRNA [GM37] methyltransferase;

Homologs  Archaea  0/68 : Bacteria  904/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.116.1
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->285 1uamA PDBj 1e-37 39.2 %
:RPS:PDB   213->285 2btlA PDBj 3e-22 19.2 %
:RPS:SCOP  12->278 1oy5A  c.116.1.4 * 1e-51 38.4 %
:HMM:SCOP  10->285 1ualA_ c.116.1.4 * 1.5e-83 52.1 %
:RPS:PFM   32->269 PF01746 * tRNA_m1G_MT 2e-48 55.4 %
:HMM:PFM   33->87 PF01746 * tRNA_m1G_MT 3.1e-14 40.7 54/186  
:HMM:PFM   127->269 PF01746 * tRNA_m1G_MT 1.3e-44 49.2 130/186  
:BLT:SWISS 1->289 TRMD_CORGL e-158 99.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54933.1 GT:GENE BAF54933.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2126019..2126888) GB:FROM 2126019 GB:TO 2126888 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54933.1 LENGTH 289 SQ:AASEQ MTSSENLDSHRLRLDVVTIFPEYLDPLRHALLGKAIEDGILEVGVHDLRNWATGGHKAVDDTPYGGGPGMVMKPEVWGPALDDVAAGRVSGAELDSASPHLKSARHDELGGVEKRAYVVEEDRDLPLLLVPTPAGKPFTQADAQAWSNEEHIVFACGRYEGIDQRVIDDAANRYRVREVSIGDYVLIGGEVAVLVIAEAVVRLIPGVLGNRRSHEEDSFSDGLLEGPSYTKPRTWRGLDVPEVLFSGNHAKVDRWRRDQALLRTQAIRPELIDASLLDSTDLKVLGLDK GT:EXON 1|1-289:0| SW:ID TRMD_CORGL SW:DE RecName: Full=tRNA (guanine-N(1)-)-methyltransferase; EC=2.1.1.31;AltName: Full=M1G-methyltransferase;AltName: Full=tRNA [GM37] methyltransferase; SW:GN Name=trmD; OrderedLocusNames=Cgl2050, cg2249; SW:KW Complete proteome; Cytoplasm; Methyltransferase;S-adenosyl-L-methionine; Transferase; tRNA processing. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->289|TRMD_CORGL|e-158|99.0|289/289| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| TM:NTM 1 TM:REGION 184->206| SEG 190->204|evavlviaeavvrli| BL:PDB:NREP 1 BL:PDB:REP 14->285|1uamA|1e-37|39.2|232/250| RP:PDB:NREP 1 RP:PDB:REP 213->285|2btlA|3e-22|19.2|73/134| RP:PFM:NREP 1 RP:PFM:REP 32->269|PF01746|2e-48|55.4|193/193|tRNA_m1G_MT| HM:PFM:NREP 2 HM:PFM:REP 33->87|PF01746|3.1e-14|40.7|54/186|tRNA_m1G_MT| HM:PFM:REP 127->269|PF01746|1.3e-44|49.2|130/186|tRNA_m1G_MT| RP:SCP:NREP 1 RP:SCP:REP 12->278|1oy5A|1e-51|38.4|211/218|c.116.1.4| HM:SCP:REP 10->285|1ualA_|1.5e-83|52.1|238/252|c.116.1.4|1/1|alpha/beta knot| OP:NHOMO 908 OP:NHOMOORG 904 OP:PATTERN -------------------------------------------------------------------- 1111111111111211111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111121111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 94.8 SQ:SECSTR ###########EEEEEEcccGGGGHHHHcHHHHHHHHTTcEEEEEEcGGGGcccTTcccEEccTTcccccEEcHHHHHHHHHHHHHHHccccEEEEEEEEHHHHHHHHHHHHcTccccccccccccEEEcccccccGGGEEHHEEEEEEEEEEEcccccccEEEEHHHHHcEEEEcTTcccEEEEEEEEEccccccccccccccEEEEEETTccccccccccEEEccTTcccccEEcccccccccccGGGcEEEEEEEEEEEEccccEEEEEEEEEEEETTccTT#### DISOP:02AL 1-9,289-290| PSIPRED ccccccccccEEEEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEEcHHHHcccccccccccccccccccEEEHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccHHcccccccccEEEEEccccccccHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcccEEEEEccEEEcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccHHccccccHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHcccc //