[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54951.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  110/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:193 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->110 2fyiC PDBj 2e-06 30.6 %
:RPS:PDB   2->186 1al3A PDBj 8e-14 17.8 %
:RPS:SCOP  2->191 1utbA  c.94.1.1 * 1e-17 15.3 %
:HMM:SCOP  2->190 1uthA_ c.94.1.1 * 1.2e-22 29.1 %
:RPS:PFM   11->185 PF03466 * LysR_substrate 5e-10 29.1 %
:HMM:PFM   2->186 PF03466 * LysR_substrate 4.5e-28 31.4 185/209  
:BLT:SWISS 5->154 YOFA_BACSU 4e-10 26.0 %
:BLT:SWISS 130->183 CPSF2_ORYSJ 3e-04 41.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54951.1 GT:GENE BAF54951.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2151042..2151623) GB:FROM 2151042 GB:TO 2151623 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54951.1 LENGTH 193 SQ:AASEQ MVSNTSAVDSLTEFLAATLNKYPELNVDLEEGSSSEVARRVREGTADLGVVSVLESRTGLEAHLLWEDPLMIVGTSAKTSVEALKGPMIGLSAGIPLQTYIDAHLERDGITPNYRVRLPTLSAVYAVASTGGGSAILPLGTARRLEVWIKNVLPIEEPWAQRDAWMLVKEGRTLADVEKSFIDALLSFRDEKS GT:EXON 1|1-193:0| BL:SWS:NREP 2 BL:SWS:REP 5->154|YOFA_BACSU|4e-10|26.0|150/285| BL:SWS:REP 130->183|CPSF2_ORYSJ|3e-04|41.2|51/738| BL:PDB:NREP 1 BL:PDB:REP 3->110|2fyiC|2e-06|30.6|108/228| RP:PDB:NREP 1 RP:PDB:REP 2->186|1al3A|8e-14|17.8|185/237| RP:PFM:NREP 1 RP:PFM:REP 11->185|PF03466|5e-10|29.1|175/207|LysR_substrate| HM:PFM:NREP 1 HM:PFM:REP 2->186|PF03466|4.5e-28|31.4|185/209|LysR_substrate| RP:SCP:NREP 1 RP:SCP:REP 2->191|1utbA|1e-17|15.3|190/214|c.94.1.1| HM:SCP:REP 2->190|1uthA_|1.2e-22|29.1|189/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 170 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- --------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------1-----1-111--1--1--11111111111-22222221-1--1-----------1------------1----------------1------------------------------------2215222232-222211322222112122233--331--111413-4-1--------------------1-----------------------1----1---------------------------------------------------------------------------1----------------------------------11111----1-----------------------------------------------------1---------------1111111-----11111123-2-22----------------------------11----1------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 96.4 SQ:SECSTR #EcHHHHHHTcHHHHHHHHHHcTEEEEEEEEccHHHHHHHHHTTcccEEEEccccTTccEEEEEEEEEcEEEEEcTTcccHHHHHTEEEEEcTTcTTHHHHHHHHHHHTcccEEEEEEccHHHHHHHHHHTccEEEEEGGGccTTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcc###### DISOP:02AL 190-194| PSIPRED cccHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEccccccccEEEEEEEEccEEEEEcccccHHHHHcccEEEcccccHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHccccEEEEEHHHHHHcccccEEEEEccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHcc //