[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54955.1
DDBJ      :             hypothetical protein
Swiss-Prot:FPG_CORGB    RecName: Full=Formamidopyrimidine-DNA glycosylase;         Short=Fapy-DNA glycosylase;         EC=3.2.2.23;AltName: Full=DNA-(apurinic or apyrimidinic site) lyase mutM;         Short=AP lyase mutM;         EC=4.2.99.18;

Homologs  Archaea  0/68 : Bacteria  726/915 : Eukaryota  55/199 : Viruses  1/175   --->[See Alignment]
a.156.1b.113.1g.39.1
:286 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->285 1pm5A PDBj 2e-41 35.9 %
:RPS:PDB   2->286 1ee8A PDBj 8e-71 34.9 %
:RPS:SCOP  2->137 1k82A2  b.113.1.1 * 4e-31 37.4 %
:RPS:SCOP  146->231 1ee8A1  a.156.1.2 * 2e-25 34.9 %
:RPS:SCOP  232->285 1ee8A3  g.39.1.8 * 9e-20 37.0 %
:HMM:SCOP  2->135 1tdhA2 b.113.1.1 * 4.7e-35 42.9 %
:HMM:SCOP  142->233 1tdhA1 a.156.1.2 * 7.9e-28 43.5 %
:HMM:SCOP  232->287 1ee8A3 g.39.1.8 * 3e-15 44.6 %
:RPS:PFM   2->125 PF01149 * Fapy_DNA_glyco 4e-19 46.0 %
:RPS:PFM   143->232 PF06831 * H2TH 2e-16 42.2 %
:RPS:PFM   256->285 PF06827 * zf-FPG_IleRS 3e-07 56.7 %
:HMM:PFM   2->128 PF01149 * Fapy_DNA_glyco 1.4e-31 43.1 116/116  
:HMM:PFM   144->229 PF06831 * H2TH 1.3e-25 41.9 86/93  
:HMM:PFM   256->285 PF06827 * zf-FPG_IleRS 3.9e-10 43.3 30/30  
:BLT:SWISS 1->286 FPG_CORGB e-168 100.0 %
:PROS 259->283|PS01242|ZF_FPG_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54955.1 GT:GENE BAF54955.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2153991..2154851) GB:FROM 2153991 GB:TO 2154851 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54955.1 LENGTH 286 SQ:AASEQ MPELPEVEVVRRGLEDHMVGHTIVSATVLHPRAARNQLGGGPEIEANIAGLRVSAAKRRGKFLWLELIDAPSGETRPDLGLLVHLGMSGQMLIKEPDAPISPHLRAKIELDNGDEVWFVDQRTFGYWWLGDLVDGVPERVSHIATDVLDESADFSAIARNLKSRKSEIKRLLLNQEIVSGIGNIYADEMLWQAKIHPLQRADRLSLARLEELLQAGKDVMTKALAQGGTSFDALYVNVNGNSGYFSLSLNAYGQTGEPCGRCGTQIVRENFMNRGSHYCPNCQKRR GT:EXON 1|1-286:0| SW:ID FPG_CORGB SW:DE RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fapy-DNA glycosylase; EC=3.2.2.23;AltName: Full=DNA-(apurinic or apyrimidinic site) lyase mutM; Short=AP lyase mutM; EC=4.2.99.18; SW:GN Name=mutM; Synonyms=fpg; OrderedLocusNames=cgR_1958; SW:KW Complete proteome; DNA damage; DNA repair; DNA-binding; Glycosidase;Hydrolase; Lyase; Metal-binding; Multifunctional enzyme; Zinc;Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->286|FPG_CORGB|e-168|100.0|286/286| GO:SWS:NREP 9 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0016798|"GO:hydrolase activity, acting on glycosyl bonds"|Glycosidase| GO:SWS GO:0008152|"GO:metabolic process"|Glycosidase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| PROS 259->283|PS01242|ZF_FPG_1|PDOC00956| BL:PDB:NREP 1 BL:PDB:REP 2->285|1pm5A|2e-41|35.9|270/271| RP:PDB:NREP 1 RP:PDB:REP 2->286|1ee8A|8e-71|34.9|261/266| RP:PFM:NREP 3 RP:PFM:REP 2->125|PF01149|4e-19|46.0|113/118|Fapy_DNA_glyco| RP:PFM:REP 143->232|PF06831|2e-16|42.2|90/92|H2TH| RP:PFM:REP 256->285|PF06827|3e-07|56.7|30/30|zf-FPG_IleRS| HM:PFM:NREP 3 HM:PFM:REP 2->128|PF01149|1.4e-31|43.1|116/116|Fapy_DNA_glyco| HM:PFM:REP 144->229|PF06831|1.3e-25|41.9|86/93|H2TH| HM:PFM:REP 256->285|PF06827|3.9e-10|43.3|30/30|zf-FPG_IleRS| GO:PFM:NREP 11 GO:PFM GO:0003684|"GO:damaged DNA binding"|PF01149|IPR012319| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF01149|IPR012319| GO:PFM GO:0006284|"GO:base-excision repair"|PF01149|IPR012319| GO:PFM GO:0008270|"GO:zinc ion binding"|PF01149|IPR012319| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF01149|IPR012319| GO:PFM GO:0003684|"GO:damaged DNA binding"|PF06831|IPR015886| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF06831|IPR015886| GO:PFM GO:0006289|"GO:nucleotide-excision repair"|PF06831|IPR015886| GO:PFM GO:0008270|"GO:zinc ion binding"|PF06831|IPR015886| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF06831|IPR015886| GO:PFM GO:0003824|"GO:catalytic activity"|PF06827|IPR010663| RP:SCP:NREP 3 RP:SCP:REP 2->137|1k82A2|4e-31|37.4|123/128|b.113.1.1| RP:SCP:REP 146->231|1ee8A1|2e-25|34.9|86/89|a.156.1.2| RP:SCP:REP 232->285|1ee8A3|9e-20|37.0|54/56|g.39.1.8| HM:SCP:REP 2->135|1tdhA2|4.7e-35|42.9|126/130|b.113.1.1|1/1|N-terminal domain of MutM-like DNA repair proteins| HM:SCP:REP 142->233|1tdhA1|7.9e-28|43.5|92/115|a.156.1.2|1/1|S13-like H2TH domain| HM:SCP:REP 232->287|1ee8A3|3e-15|44.6|56/56|g.39.1.8|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 898 OP:NHOMOORG 782 OP:PATTERN -------------------------------------------------------------------- 1321211111111143322-22113222222222322222121143121212232214--22312232221-----------3-------2--1---------1-1--11--------------1-----------11-1111111111111111111111111111111111121111121111111---111111111111111111211111111111111111111122111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111----------------------------1--113311111111-------3-11111111111111121111111111111111-1-1111111111111111111111111111111111111111111111111111111111-1111----1-1111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111111---111111111112121111112212211--------------------------111111111111111111111111111111111-11111------22112121111111111-1111111111111111111212221111221212111112111211111111-111111111111---1-----111111211111111111111111-111111111111111111111111111111111111112111111111111111111111112222111-----------------111111-1111111111111111111-----------2- --------------1111-111-1111111111-11--------11--1111111-1-1111------------------------------11--2-----------6--------------------------1-------------------11------1------------111111--23221121------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 285 STR:RPRED 99.7 SQ:SECSTR #ccHHHHHHHHHHHHHHHTTcEEEEEEcccTTTHHcccTTHEEcGGGGTTEEEEEEEEETTEEEEEETTTEEEETTcEEEEEEEcTTTcEEEccccTccccTTEEEEEEEccccEEEEEcTTcccEEETTcccHTTcTHHHHccccTTcTTccHHHHHHHHHTccccHHHHHHHccccTTccHHHHHHHHHHTTccccccGGGccHHHHHHHHHHHHHHHHHHHHTTccccccccccTTccccccGGGcccTTcTTcccTTTccccEEEEccccEEEEcTTTTTcc DISOP:02AL 286-287| PSIPRED cccccHHHHHHHHHHHHHcccEEEEEEEEcccEEEccccccHHHHHHHcccEEEEEEEcccEEEEEEcccccccccccEEEEEEcccccEEEEEEccccccccEEEEEEEccccEEEEEcccccEEEEEEcccHHHHHHHcccccccccccccHHHHHHHHccccccHHHHHHcccEEcccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccEEEEEccccccccccccEEEEEEEccEEEEEcccccccc //