[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54977.1
DDBJ      :             hypothetical protein
Swiss-Prot:HIS4_CORGL   RecName: Full=1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase;         EC=5.3.1.16;AltName: Full=Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase;

Homologs  Archaea  55/68 : Bacteria  714/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:246 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->241 2vepA PDBj 9e-68 53.6 %
:RPS:PDB   1->246 2a0nA PDBj 8e-25 26.1 %
:RPS:SCOP  5->237 1qo2A  c.1.2.1 * 6e-60 26.8 %
:HMM:SCOP  1->243 1vzwA1 c.1.2.1 * 2.8e-60 37.7 %
:RPS:PFM   5->230 PF00977 * His_biosynth 3e-30 38.3 %
:HMM:PFM   5->234 PF00977 * His_biosynth 2.8e-66 41.7 223/228  
:BLT:SWISS 1->246 HIS4_CORGL e-140 100.0 %
:REPEAT 2|8->121|125->246

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54977.1 GT:GENE BAF54977.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2177552..2178292) GB:FROM 2177552 GB:TO 2178292 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54977.1 LENGTH 246 SQ:AASEQ MTFTILPAVDVVNGQAVRLDQGEAGTEKSYGTPLESALKWQEQGAKWLHFVDLDAAFNRGSNHEMMAEIVGKLDVDVELTGGIRDDESLERALATGARRVNIGTAALEKPEWIASAIQRYGEKIAVDIAVRLEDGEWRTRGNGWVSDGGDLWEVLERLDSQGCARFVVTDVSKDGTLSGPNVELLREVAAATDAPIVASGGISVLEDVLELAKYQDEGIDSVIIGKALYEHKFTLEEALAAVEKLG GT:EXON 1|1-246:0| SW:ID HIS4_CORGL SW:DE RecName: Full=1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC=5.3.1.16;AltName: Full=Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; SW:GN Name=hisA; OrderedLocusNames=Cgl2096, cg2299; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->246|HIS4_CORGL|e-140|100.0|246/246| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| NREPEAT 1 REPEAT 2|8->121|125->246| BL:PDB:NREP 1 BL:PDB:REP 5->241|2vepA|9e-68|53.6|233/240| RP:PDB:NREP 1 RP:PDB:REP 1->246|2a0nA|8e-25|26.1|241/251| RP:PFM:NREP 1 RP:PFM:REP 5->230|PF00977|3e-30|38.3|222/229|His_biosynth| HM:PFM:NREP 1 HM:PFM:REP 5->234|PF00977|2.8e-66|41.7|223/228|His_biosynth| GO:PFM:NREP 1 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00977|IPR006062| RP:SCP:NREP 1 RP:SCP:REP 5->237|1qo2A|6e-60|26.8|228/241|c.1.2.1| HM:SCP:REP 1->243|1vzwA1|2.8e-60|37.7|239/0|c.1.2.1|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 1572 OP:NHOMOORG 772 OP:PATTERN ---2--2122222222-2122122222222222123323233222222322222-2-222-2----12 2222222222222222211-12222222222222222222222222232222222222--122222222222222222--22222222222222-----2-222222222---------------222222223222222233322222222222222223222222222222222223233222222222222222222222222222222222222222122222222221-22222222222222222-2----22-2---22--21----2-222-------222------------------------2----2----22-2222222-2-2222222---2-2--2212222222222222222--22222222-----222222322222222222222222122222222222-2222222222222222222222222332222222222222222-----------------------------232222222222222222222222222222222222222222222222223222323222222222222222222221323-222222222-2223223222222223342222333332-2-------22222222222222212222222222222222222222--222222222222222222222222222-2222222222222222222222223322222222222222222222222222-22222221222222-2-----333322321221222-2221---2222222222222322222222222222222--------222222222222223222222222222222222223322--------------------------------------2--2-222221 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 246 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEEEETTEETTccccTTccEEcTTcHHHHHHHHHHHTccEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHTccEEEEcHHHHHcTHHHHHHHHHHcGGGEEEEEEEEEETTEEEEETTTTEEEEEHHHHHHHHHHTTccEEEEEETTTTTccccccHHHHHHHGGGccccEEEEcccccHHHHHHHHHHHHTTccEEEEcHHHHTTcccHHHHHHHHHHTT PSIPRED ccEEEEEEEEEEccEEEEEEccccccccccccHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEccHHHccHHHHHHHHHHccccEEEEEEEEEEccEEEEEEccccccccHHHHHHHHHHHccccEEEEEcccHHHHcccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHccccEEEEEEHHHcccccHHHHHHHHHHcc //