[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54981.1
DDBJ      :             hypothetical protein
Swiss-Prot:HIS7_CORGL   RecName: Full=Imidazoleglycerol-phosphate dehydratase;         Short=IGPD;         EC=4.2.1.19;

Homologs  Archaea  55/68 : Bacteria  713/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->191 2f1dA PDBj 2e-47 50.5 %
:RPS:PDB   12->187 2ae8A PDBj 4e-42 36.8 %
:RPS:SCOP  4->90 1rhyA1  d.14.1.9 * 1e-27 44.4 %
:RPS:SCOP  91->186 1rhyA2  d.14.1.9 * 3e-17 35.9 %
:HMM:SCOP  5->90 2f1dA1 d.14.1.9 * 1.8e-35 58.1 %
:HMM:SCOP  91->188 1rhyA2 d.14.1.9 * 7.4e-28 52.1 %
:RPS:PFM   35->183 PF00475 * IGPD 4e-40 56.6 %
:HMM:PFM   35->183 PF00475 * IGPD 3.5e-61 56.6 145/145  
:BLT:SWISS 1->202 HIS7_CORGL e-116 100.0 %
:PROS 65->78|PS00954|IGP_DEHYDRATASE_1
:PROS 164->176|PS00955|IGP_DEHYDRATASE_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54981.1 GT:GENE BAF54981.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2181539..2182147) GB:FROM 2181539 GB:TO 2182147 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54981.1 LENGTH 202 SQ:AASEQ MTVAPRIGTATRTTSESDITVEINLDGTGKVDIDTGLPFFDHMLTAFGVHGSFDLKVHAKGDIEIDAHHTVEDTAIVLGQALLDAIGDKKGIRRFASCQLPMDEALVESVVDISGRPYFVISGEPDHMITSVIGGHYATVINEHFFETLALNSRITLHVICHYGRDPHHITEAEYKAVARALRGAVEMDPRQTGIPSTKGAL GT:EXON 1|1-202:0| SW:ID HIS7_CORGL SW:DE RecName: Full=Imidazoleglycerol-phosphate dehydratase; Short=IGPD; EC=4.2.1.19; SW:GN Name=hisB; OrderedLocusNames=Cgl2100, cg2303; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->202|HIS7_CORGL|e-116|100.0|202/202| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| PROS 65->78|PS00954|IGP_DEHYDRATASE_1|PDOC00738| PROS 164->176|PS00955|IGP_DEHYDRATASE_2|PDOC00738| BL:PDB:NREP 1 BL:PDB:REP 6->191|2f1dA|2e-47|50.5|182/183| RP:PDB:NREP 1 RP:PDB:REP 12->187|2ae8A|4e-42|36.8|163/166| RP:PFM:NREP 1 RP:PFM:REP 35->183|PF00475|4e-40|56.6|145/145|IGPD| HM:PFM:NREP 1 HM:PFM:REP 35->183|PF00475|3.5e-61|56.6|145/145|IGPD| GO:PFM:NREP 2 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00475|IPR000807| GO:PFM GO:0004424|"GO:imidazoleglycerol-phosphate dehydratase activity"|PF00475|IPR000807| RP:SCP:NREP 2 RP:SCP:REP 4->90|1rhyA1|1e-27|44.4|81/86|d.14.1.9| RP:SCP:REP 91->186|1rhyA2|3e-17|35.9|92/94|d.14.1.9| HM:SCP:REP 5->90|2f1dA1|1.8e-35|58.1|86/0|d.14.1.9|1/2|Ribosomal protein S5 domain 2-like| HM:SCP:REP 91->188|1rhyA2|7.4e-28|52.1|94/0|d.14.1.9|2/2|Ribosomal protein S5 domain 2-like| OP:NHOMO 912 OP:NHOMOORG 885 OP:PATTERN ---1--1111111111-1111111111111111111111111111111211111-1-111-1----11 1111111111111111111-11111111111111111111121111111111111111--111111111111111111--11111111111111-----1-111111111---------------111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-1----11-1---11--11----1-111-------111------------------------1----1----11-1111111-1-1111111---1-1--1111111111111111111--11111111-----111111111111111111111111111111111111-1111111111111111111111111111111111111111111-----------------------------11111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111-1111111111111111111111111111-1-------11111111111111111111111111111111111111--111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1-----111111111111111-1111---1111111111111111111111111111111--------111111111111111111111111111111111111111--------------------------------------1--1-111111 ------1-----221-111111112111111-1111-1111111111111111111111111111111111111-111--11111111-12111111111111111-11-------------------------------------------------1----2-1-------1-1111C111-111131312112111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 92.1 SQ:SECSTR #####cEEEEEEEEEccEEEEEEETccccccEEEcccHHHHHHHHHHHHHHccEEEEEEEccTTccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcEEETTEEEEEEEEcccccEEEEEccccccEEccEETTEETTHHHHHHHHHHHHTTcEEEEEEEEcccHHHHHHHHHHHHHHHHHHHTccccc########### DISOP:02AL 1-5| PSIPRED cccccEEEEEEEEcccEEEEEEEEEcccEEEEEEccccHHHHHHHHHHHHccccEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEEEEEHHHHEEEEEEEccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //