[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54985.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:217 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   53->176 PF10821 * DUF2567 7.3e-06 26.0 123/167  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54985.1 GT:GENE BAF54985.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2186129..2186782) GB:FROM 2186129 GB:TO 2186782 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54985.1 LENGTH 217 SQ:AASEQ MTYPGITSDHNPYDGYTGDDGAGIKRNLPNRKKINKSVGVYAGVFALTLALYAIGGAAWGLLRPTYTAYVEDAETASIAVETNTSFAGYAWFAIATGVLAAAIALFVFLRTPQHRGPVMLIWLGIVSIAGSVAFLVFGNVASTMLHGSPSDYASAIGASFQVAPTITPGVAFGVAPFLSVCMYWCAAFVTPEEEIDQDDAGQGTSKASGSEMTGASD GT:EXON 1|1-217:0| TM:NTM 4 TM:REGION 37->59| TM:REGION 87->109| TM:REGION 120->142| TM:REGION 162->184| SEG 93->109|aiatgvlaaaialfvfl| HM:PFM:NREP 1 HM:PFM:REP 53->176|PF10821|7.3e-06|26.0|123/167|DUF2567| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,195-218| PSIPRED ccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcHHHcccHHHEHHHHHHHHHHcccHHHHHHHHcccEEEcccccccHHHHHHHHHHHHHHHHHHHcccHHHHcHHHcccccccccccccccccc //