[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54986.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->205 PF01298 * Lipoprotein_5 1.3e-05 23.5 187/593  
:BLT:SWISS 105->215 NEST_MOUSE 8e-04 24.3 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54986.1 GT:GENE BAF54986.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2186857..2187513) GB:FROM 2186857 GB:TO 2187513 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54986.1 LENGTH 218 SQ:AASEQ MSIRLSSKKAAFAALMVTPLLLTACSSESSDTEAASSSAATTTNSSSSSATTSAEAVETTSSESESESESSEATTINEEQQAQLDVLSQELSENPITFAEAAPVENGQTASPEDTAAIEALVRGYTDTNTLRSSLAYTINNTCTRVLEASGADATQLDLNTIPDIPLGGEGTGTVDSITDVVVNGQEASAWVVATAGGTTDSATQRFFNEGGQWKFCD GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 105->215|NEST_MOUSE|8e-04|24.3|111/100| COIL:NAA 20 COIL:NSEG 1 COIL:REGION 64->83| SEG 23->75|tacssessdteaasssaatttnsssssattsaeavettssesesesesseatt| HM:PFM:NREP 1 HM:PFM:REP 13->205|PF01298|1.3e-05|23.5|187/593|Lipoprotein_5| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -----111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,28-96,104-114| PSIPRED ccEEEccHHHHHHHHHHHHHHHEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHcccEEEEEEcccccEEccccHHccccccccccccccccEEEEEEEcccccEEEEEEcccccHHHHHHHHHHcccEEEcc //