[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54990.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  238/915 : Eukaryota  51/199 : Viruses  0/175   --->[See Alignment]
c.1.15
:258 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   86->249 1k77A PDBj 2e-14 33.1 %
:RPS:PDB   4->254 3cqjA PDBj 4e-23 19.8 %
:RPS:SCOP  4->254 1k77A  c.1.15.5 * 1e-50 28.5 %
:HMM:SCOP  2->256 1k77A_ c.1.15.5 * 3.7e-56 33.2 %
:RPS:PFM   120->215 PF01261 * AP_endonuc_2 1e-05 34.4 %
:HMM:PFM   44->217 PF01261 * AP_endonuc_2 1.5e-25 25.0 164/211  
:BLT:SWISS 86->254 HYI_HUMAN 3e-20 35.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54990.1 GT:GENE BAF54990.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2191672..2192448) GB:FROM 2191672 GB:TO 2192448 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54990.1 LENGTH 258 SQ:AASEQ MTFKLAACAEMIYQDLPFEERVKTISDQGFLVEIWDWSTKDIDALVATGAEFSSMTGYLRGDLITEQGRAELLATASESLAVAEKLNCPRLNLHGTGLGPQGLPVTPIEVVTPEMWLYAAETLRQIAELGERAGKVFVLENLNLAVDHPGTPFAKATDTLVLVKAVNHPNLRLNLDLYHAQIGEGNLIELLREAQPFIDEIQVADVPGRMEPGTGEINYQGVAKALAAMGYDGVIGMEAWASGDSSDALQALKSAFTV GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 86->254|HYI_HUMAN|3e-20|35.2|165/277| SEG 70->84|aellataseslavae| BL:PDB:NREP 1 BL:PDB:REP 86->249|1k77A|2e-14|33.1|154/256| RP:PDB:NREP 1 RP:PDB:REP 4->254|3cqjA|4e-23|19.8|237/276| RP:PFM:NREP 1 RP:PFM:REP 120->215|PF01261|1e-05|34.4|90/200|AP_endonuc_2| HM:PFM:NREP 1 HM:PFM:REP 44->217|PF01261|1.5e-25|25.0|164/211|AP_endonuc_2| RP:SCP:NREP 1 RP:SCP:REP 4->254|1k77A|1e-50|28.5|242/260|c.1.15.5| HM:SCP:REP 2->256|1k77A_|3.7e-56|33.2|244/0|c.1.15.5|1/1|Xylose isomerase-like| OP:NHOMO 466 OP:NHOMOORG 289 OP:PATTERN -------------------------------------------------------------------- --3-----222----------1---2------1----132----2----------------1----112-------------1----------1---------122-5-2--------------------------222---------------------------------------------1---------------------------------111-----------------------------------------------------------------------------------------------------------------1---1-----------------11---------------1-31--------11221--11-11111111111111-1111121213--3---3333433222---1-1----1-1--------2------1-------------------------------2---111-12222222111-223222221222322221222221---212122111----------------111---------1---1---------------------------------------------1--11---1-1-----------------------------------1--12112232322-12222212-212122222-1231111-2-22112222222222211----2--1-------------------------1111---1-1--1-11111111111----3-22221213211121221----------1--1-----1---------------------------------------------------------------------------1- ------1-----------------------------------------------------------------------------------------------------1-2111-1111--11-2-1518B1-324-1-121111-1-1111-11211122-1211-1114--2------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 99.6 SQ:SECSTR #cccEEEEGGGccccccHHHHHHHHHHTTcEEEEEGccHHHHHHHHHHccEEEEEEEGGGTccTTHHHHHHHHHHHHHHHHHHHHHTccEEEEccccccccccccccGGGccHHHHHHHHHHHHHHHHHHHHHTcEEEEEccccccccccGGGccHHHHHHHHHHHccTTEEEEccHHHHHcccccHHHHHHHTGGGcccEEEcEEEEEEcTTcccccHHHHHHHHHHTTccccEEEcccGGGcccHHHHHHHHHHHH PSIPRED cccHHHEEHHHHcccccHHHHHHHHHHcccEEEEccccHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccHHHccHHHHHHHHHHcccccEEEEEccHHHHHccccHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHHccccEEEEEEEEEccccHHHHHHHHHHHcc //