[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55009.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  27/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.22
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->376 1xr2B PDBj 6e-13 30.4 %
:RPS:PDB   1->399 3bq6B PDBj 9e-24 21.1 %
:RPS:SCOP  1->399 1u1hA2  c.1.22.2 * 8e-33 21.7 %
:HMM:SCOP  6->400 1u1jA1 c.1.22.2 * 3e-53 30.5 %
:RPS:PFM   9->391 PF01717 * Meth_synt_2 4e-18 33.6 %
:HMM:PFM   8->64 PF01717 * Meth_synt_2 2.6e-10 35.1 57/324  
:HMM:PFM   195->393 PF01717 * Meth_synt_2 2.7e-13 27.6 181/324  
:BLT:SWISS 8->399 METE_THEP1 4e-14 28.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55009.1 GT:GENE BAF55009.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2211000..2212205) GB:FROM 2211000 GB:TO 2212205 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55009.1 LENGTH 401 SQ:AASEQ MSQNRIRTTHVGSLPRTPELLDANIKRSNGEIGEEEFFQILQSSVDDVIKRQVDLGIDILNEGEYGHVTSGAVDFGAWWNYSFTRLGGLTMTDTDRWASQEAVRSTPGNIKLTSFSDRRDRALFSEAYEDPVSGIFTGRASVGNPEFTGPITYIGQEETQTDVDLLKKGMNAAGATDGFVAALSPGSAARLTNKFYDTDEEVVAACADALSQEYKIITDAGLTVQLDAPDLAEAWDQINPEPSVKDYLDWIGTRIDAINSAVKGLPKEQTRLHICWGSWHGPHVTDIPFGDIIGEILRAEVGGFSFEGASPRHAHEWRVWEENKLPEGSVIYPGVVSHSINAVEHPRLVADRIVQFAKLVGPENVIASTDCGLGGRLHSQIAWAKLESLVEGARIASKELF GT:EXON 1|1-401:0| BL:SWS:NREP 1 BL:SWS:REP 8->399|METE_THEP1|4e-14|28.4|317/735| BL:PDB:NREP 1 BL:PDB:REP 8->376|1xr2B|6e-13|30.4|296/728| RP:PDB:NREP 1 RP:PDB:REP 1->399|3bq6B|9e-24|21.1|332/718| RP:PFM:NREP 1 RP:PFM:REP 9->391|PF01717|4e-18|33.6|304/323|Meth_synt_2| HM:PFM:NREP 2 HM:PFM:REP 8->64|PF01717|2.6e-10|35.1|57/324|Meth_synt_2| HM:PFM:REP 195->393|PF01717|2.7e-13|27.6|181/324|Meth_synt_2| GO:PFM:NREP 2 GO:PFM GO:0003871|"GO:5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity"|PF01717|IPR002629| GO:PFM GO:0009086|"GO:methionine biosynthetic process"|PF01717|IPR002629| RP:SCP:NREP 1 RP:SCP:REP 1->399|1u1hA2|8e-33|21.7|318/352|c.1.22.2| HM:SCP:REP 6->400|1u1jA1|3e-53|30.5|331/0|c.1.22.2|1/1|UROD/MetE-like| OP:NHOMO 32 OP:NHOMOORG 29 OP:PATTERN ------------------------------------------------------1------------- --1--2-1111--1----------------------------1-1-11122---11---------------------------------------------1-------------------------------------11------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------1-----------------------------------------1----------------------------------------------11-----1-------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------- -------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 387 STR:RPRED 96.5 SQ:SECSTR HccccccccccccccccHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHTccccEEccccccccccTTcccTTHHHHTTcEEEEccccccEEETcEETTEEEcccEEEHHHHHcTTc###EEcccEEEcTTccEEEEEEEccccccHHHHHHHHTTccccccEEEEcHHHHcHHHHHHTcEHHTcEEcccccHHHHHHHHHHHHHHHHHHHHHTTcccEEcEEEEEcTHHHHTccccGGGHHHHHHHHHHHHHHHTcccTTcEEEEEcccccc########ccTTTHHHHTTccccEEEEcTTTTTGGGHHHHHTcTTccTTcEEEEEcccTTccccccHHHHHHHHHHHTTTccGGGEEEEcccccTTccHHH#HHHHHHHHHHHHHHHHHc## DISOP:02AL 1-1| PSIPRED cccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccEEEcccEEccccccHHHHHHHHHHHHccccEEEEcccccEEEcccEEccccEEEEEEEcccccHHHHHHHHcccccccccccccccccccccEEEHHHHccHHHHHHHccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHcccHHccccccccHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccccccHHHHHHHHHHccccEEEEEEcccccccHHHHHHHcccccccEEEEEEEEccccccccHHHHHHHHHHHHHcccHHHEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHc //