[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55014.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  872/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:295 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->280 3i3oE PDBj 2e-69 48.9 %
:RPS:PDB   41->280 1dohB PDBj 1e-51 26.9 %
:RPS:SCOP  46->280 1c14A  c.2.1.2 * 6e-50 21.1 %
:HMM:SCOP  46->291 1zemA1 c.2.1.2 * 1.2e-78 40.2 %
:RPS:PFM   51->216 PF00106 * adh_short 7e-24 42.3 %
:HMM:PFM   53->216 PF00106 * adh_short 1.6e-31 25.5 161/167  
:BLT:SWISS 2->280 YGHA_ECOLI 1e-75 52.7 %
:PROS 187->215|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55014.1 GT:GENE BAF55014.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2218670..2219557) GB:FROM 2218670 GB:TO 2219557 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55014.1 LENGTH 295 SQ:AASEQ MISLLNDPRTLFPKVDPPKQSQPEPGLDIKLSPQADIGLSSYQGSGRLKGRKALITGGDSGIGAAVAIAYAREGADVSIAYLPEEQADADRVLHAIEETGQKAFSFPGDLRDPEYCRSLVQETVNALGGLDILVNNASRQVWAPGLTEITDENFDQTLQVNLYGSFRVTKAAIPHLKPGSSIIFTSSIQAYQPSETLLDYAMTKAALNNLSKGLASSLIGDGIRVNSVAPGPFWTPLQPSHGQPQEKIEGFGQHAPIGRAGHPVELAGAYVFLASDEASYVVGETLGVTGGTPTP GT:EXON 1|1-295:0| BL:SWS:NREP 1 BL:SWS:REP 2->280|YGHA_ECOLI|1e-75|52.7|279/294| PROS 187->215|PS00061|ADH_SHORT|PDOC00060| SEG 281->294|vvgetlgvtggtpt| BL:PDB:NREP 1 BL:PDB:REP 17->280|3i3oE|2e-69|48.9|262/279| RP:PDB:NREP 1 RP:PDB:REP 41->280|1dohB|1e-51|26.9|238/271| RP:PFM:NREP 1 RP:PFM:REP 51->216|PF00106|7e-24|42.3|163/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 53->216|PF00106|1.6e-31|25.5|161/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 46->280|1c14A|6e-50|21.1|232/256|c.2.1.2| HM:SCP:REP 46->291|1zemA1|1.2e-78|40.2|244/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 15623 OP:NHOMOORG 1116 OP:PATTERN 2221246ACACABAA519454321B449576922---------21144--522-24122132843-44 IJe3c1-466B141e*vOP-Oz22f*ONNONX****g***6nC*NID94F93REJ53922HHV3KJXYfQC11112111287V22434666727221--84S4DGxBbAL111111111111113833AD434886IEEML222JDGBHD7667733311744573DJCV9233233333313IB79A771H7OGGHGHGHJFGIHHIHMHQQINHGGBHIMOIC999998Ig8555554455555549AA8C91D16815-1-69555655678A655656455632222222333333353344454444533322133364358C5554444547846626757331188212B7123224333355522B2KiLLS22322OF*ee49BVQSTPKLMLJKMLMMV-INQJGlIOWxf2*hhLjgp**xrsXYGMCNNWMFLQIGL88888888JXVE9BEB33211222111213333342232231111AHw*M8GZRJY*jouwsRRQRNll*tVUVUBS*W*V*qg4ATRLJAJGFRNcImY8HC786E94222111136BMF97N8D212211533435874F5484AB9ANR333445322323-2422222223253499BB78CFBALC57B98B8CA8969B588A6C1-3364A11-111DHDG6M9EGGDEDDDFF-GEFEFDDDEEGDGEDEFEFQWPFA9AAC8ABBCCBCCBABABCVDDADCBE41A88888888887111957465DBBC3FKNJ111538122221462JKKPL9I9DAMASTPRLSZbNKLRQKPLP6332253233445E6566589789LLHIKHH88955652263886566--------1-3----2-----1--------------34421656763C3 11--I9E-3-3-4BDfojaoclX*n*kLLCLIJOOMMUKQLQRHIHWRfkp***RSXNLNKJ9CH3594E32F9G232148FGHLH-B-SvLoEVGDEC9F9GHGF-DH8*NVMHMB51335G9DB2E6YzI-EDI7487J68F81A428B-2F7B7FPikTAhSQIEDKNGWPN7AA7f2238LLXc*dpKDDNCBD9 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 279 STR:RPRED 94.6 SQ:SECSTR #HHHHHHTTcccccEEEcTTcHHHHTTHHHHHHHHHHHHHccGGGGccTTcEEEETTTTcHHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHHHHHHTTccEEEEEccTTcHHHHHHHHHHHHHHHccccEEEEccccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHccTcEEEEEccGGGTcccccccHHHHHHHHHHHHHHHHHHHHHGGGTcEEEEEEEcccccHHHHHHGGGGcTHHHHHHccTTcccccHHHHHHHHHHHHcGGGTT############### DISOP:02AL 1-6,8-11,15-46| PSIPRED ccccccccHHHccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEccccccccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccEEEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEccccccc //