[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55018.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  902/915 : Eukaryota  134/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:310 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   84->308 1v9fA PDBj 2e-35 40.3 %
:RPS:PDB   7->119 1c05A PDBj 3e-09 15.3 %
:RPS:PDB   90->309 2ab4A PDBj 3e-31 13.0 %
:RPS:SCOP  16->105 1dm9A  d.66.1.3 * 1e-06 12.5 %
:RPS:SCOP  86->309 1v9kA  d.265.1.3 * 3e-55 35.5 %
:HMM:SCOP  19->119 1c06A_ d.66.1.2 * 8.6e-07 22.2 %
:HMM:SCOP  75->308 1przA_ d.265.1.3 * 1.1e-66 41.3 %
:RPS:PFM   93->246 PF00849 * PseudoU_synth_2 8e-22 43.8 %
:HMM:PFM   92->246 PF00849 * PseudoU_synth_2 5.9e-33 35.6 149/164  
:HMM:PFM   18->56 PF01479 * S4 4.1e-06 41.0 39/48  
:BLT:SWISS 7->308 Y1567_MYCBO e-101 61.9 %
:PROS 138->152|PS01129|PSI_RLU
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55018.1 GT:GENE BAF55018.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2224002..2224934) GB:FROM 2224002 GB:TO 2224934 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55018.1 LENGTH 310 SQ:AASEQ MNNRQSRTLPVPEGLAGMRVDAALSKLLGISRTVAAELATAGDVSVDGAVVGKSERLVADSMLDVLLPEPAAPLMPKEEIVPGLDILYSDDDVIAVNKPVGVAAHPTVGWEGPTVVGGLAAAGFRISTSGPPERKGIVQRLDVGTSGVMVVAASERGYTVLKRAFRDRTVDKTYHALVQGHPDPLTGTIEAPIGRHPSAGWRFAVTTEGKHAVTHYETLEAFQEATLLKIHLETGRTHQIRVHFSALHHPCCGDPMYGSDPALSERLGLNRQWLHAVSLGFNHPADGRWMEIVSPYPTDLQHALDVLREQ GT:EXON 1|1-310:0| BL:SWS:NREP 1 BL:SWS:REP 7->308|Y1567_MYCBO|e-101|61.9|302/308| PROS 138->152|PS01129|PSI_RLU|PDOC00869| SEG 41->52|agdvsvdgavvg| BL:PDB:NREP 1 BL:PDB:REP 84->308|1v9fA|2e-35|40.3|221/250| RP:PDB:NREP 2 RP:PDB:REP 7->119|1c05A|3e-09|15.3|111/159| RP:PDB:REP 90->309|2ab4A|3e-31|13.0|192/300| RP:PFM:NREP 1 RP:PFM:REP 93->246|PF00849|8e-22|43.8|146/149|PseudoU_synth_2| HM:PFM:NREP 2 HM:PFM:REP 92->246|PF00849|5.9e-33|35.6|149/164|PseudoU_synth_2| HM:PFM:REP 18->56|PF01479|4.1e-06|41.0|39/48|S4| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 16->105|1dm9A|1e-06|12.5|88/104|d.66.1.3| RP:SCP:REP 86->309|1v9kA|3e-55|35.5|217/227|d.265.1.3| HM:SCP:REP 19->119|1c06A_|8.6e-07|22.2|99/159|d.66.1.2|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 75->308|1przA_|1.1e-66|41.3|230/252|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 2819 OP:NHOMOORG 1041 OP:PATTERN --------------------------------------11111------------------------- 2121121222221212211-11111211111111112121111111221111111211111111111221111111112111111222444414-211122223233424-2222222-211114111111111112222211121223233311223332323212222113111113111133311221433-3333333333333322333333333333223333334533333333333333333333-34344343334444444443333333333333333333333333333333333333333333333333332333333333333343223333334332332133141121212223122214333322222333333333333322222222223-323333332232233222222222334433333333333333333333333334222222222221122222222222222-222333332222222232222222222222222222222222222243534533432333322245233333322225461324371223221133333433477779724233232222223333333333333322664544547534888879966678-987892-3233322122234444454444444444-44444444444444444434444444533333333333333335444444431544444444444222422222222233625555455454554445444344434436333333333-33434332222222226777466666666664533333333222222443322221221121232211111-21111211111122111122222222222242 ----112-1--122311--------------------------------1------1-----22122211222212322221111111-12112111-11-1121-1191422222--111131331214A3-313-1--42221121-2322333132-113322-4113-1111222F668134115-549561116 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 303 STR:RPRED 97.7 SQ:SECSTR ######THHHHccHHccEEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcTTccEEETTEEEccccGTTccccGccHHHHHccEEEEEEEcccccHHHHHHHHHHHTHHHTccHcGGHHHHTTcccEEEcccccTTcEEEEEEEEGGGHHHHGGGGGGGTTccEEEEEEEEETEEETTccTTTTcEEEEEccccccccccccEEEEEEEEEEEEEETTEEEEEEEEcTTccHHHHHHHHHHHHTccEEEEETEEEEEEEEEEEEEETTEETTTcccTTTccHHHHHHHcEEGGGccTTccE# DISOP:02AL 1-4,310-311| PSIPRED ccccEEEEEEEccccccccHHHHHHHcccccHHHHHHHHHcccEEEccEEEccccEEccccEEEEEcccccccccccccccccEEEEEEcccEEEEEccccEEEEcccccccccHHHHHHHHHHHHHHccccccEEEEEEccccccEEEEEEEcHHHHHHHHHHHHHcccEEEEEEEEEEEEccccEEEEccccccccccEEEEEcccccccccEEEEEEEEccEEEEEEEEcccccHHHHHHHHHccccEEcccccccccccccccccccEEEEEEEEEEcccccccEEEEEccccHHHHHHHHHHHcc //