[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55027.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  222/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->77 1r8dB PDBj 7e-12 37.3 %
:RPS:PDB   1->109 3d70A PDBj 1e-19 24.8 %
:RPS:SCOP  3->104 1jbgA  a.6.1.3 * 7e-17 26.5 %
:HMM:SCOP  1->104 1jbgA_ a.6.1.3 * 1e-23 38.5 %
:RPS:PFM   3->38 PF00376 * MerR 1e-07 58.3 %
:HMM:PFM   3->38 PF00376 * MerR 3e-17 55.6 36/38  
:HMM:PFM   43->102 PF09278 * MerR-DNA-bind 3.3e-06 27.1 59/65  
:BLT:SWISS 1->99 HMRR_SINMW 3e-14 41.4 %
:PROS 4->26|PS00552|HTH_MERR_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55027.1 GT:GENE BAF55027.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2233824..2234264) GB:FROM 2233824 GB:TO 2234264 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55027.1 LENGTH 146 SQ:AASEQ MLIGEVSKLSGVSARMLRHYEKLGLVEPKQSTAGYREYSEGDVRRIFHIEGLRSLGLSLKQVGDALEDPDFDPQAVISEMIAETSARISMERELLARLKAVRHAQASDWESALDAVQILRRLRSGDPAQRQAVAFDSVSGKEAVAR GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 1->99|HMRR_SINMW|3e-14|41.4|99/147| PROS 4->26|PS00552|HTH_MERR_1|PDOC00477| BL:PDB:NREP 1 BL:PDB:REP 3->77|1r8dB|7e-12|37.3|75/107| RP:PDB:NREP 1 RP:PDB:REP 1->109|3d70A|1e-19|24.8|109/276| RP:PFM:NREP 1 RP:PFM:REP 3->38|PF00376|1e-07|58.3|36/37|MerR| HM:PFM:NREP 2 HM:PFM:REP 3->38|PF00376|3e-17|55.6|36/38|MerR| HM:PFM:REP 43->102|PF09278|3.3e-06|27.1|59/65|MerR-DNA-bind| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 1 RP:SCP:REP 3->104|1jbgA|7e-17|26.5|102/106|a.6.1.3| HM:SCP:REP 1->104|1jbgA_|1e-23|38.5|104/106|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 307 OP:NHOMOORG 222 OP:PATTERN -------------------------------------------------------------------- -21---1-222--1-----------1-------1112311--11-11-------------34--1-32431---------21-------------------------------------------------------------12-1-1-----------------1-----------------12-------122222132-2123311111-1311-1--1--11111122--------------------1-1------------------------------1--1--11-----1-------------1----------11-11111111111-1---22--1---2----22-------1----------1--2------------11--------------1-111112222----122--31-122----2---1-11-----------1-----2--------------------------------1-1-1111-1111111----11--11111234-1111--21--2-2221111-11---1-------------------------------------11------1------------------------------11--1----------------3--1-2--------1-------1------------------------------------------1----------------1------------------------1-----1111------------1111----223321----1211121111121212-11-----------11------111--11--1-------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 74.7 SQ:SECSTR EEHHHHHHHHTccHHHHHHHHHTTccccEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH##################################### DISOP:02AL 122-139,142-147| PSIPRED ccHHHHHHHHcccHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcc //