[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55040.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  811/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:550 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   45->403 PF01098 * FTSW_RODA_SPOVE 1e-47 34.2 %
:RPS:PFM   440->531 PF10243 * MIP-T3 4e-04 27.8 %
:HMM:PFM   45->404 PF01098 * FTSW_RODA_SPOVE 8e-87 35.5 352/359  
:BLT:SWISS 2->503 FTWH_MYCTU 3e-47 35.2 %
:PROS 362->386|PS00428|FTSW_RODA_SPOVE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55040.1 GT:GENE BAF55040.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2247771..2249423) GB:FROM 2247771 GB:TO 2249423 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55040.1 LENGTH 550 SQ:AASEQ MTTGASKKPARPNTGAKTRTGLGIRERISGAWNDLLARPLTDYIMILCIVVILSCLGVVMVYSSSMTWSLREGGSVWATAVRQGIMIVLGFFAMWVALMTRPQTIRNLSNLILIVSIVLLLAVQIPGIGTGKEEVGSQSWIALGPIQFQPSEIAKVAIAVWGAHYLAGKGPVQHWFNNHLMRFGGVGAFMAFLIFMEGDAGMAMSFVLVVLFMLFFAGIAMGWIAIAGVLIIAALAVLALGGGFRSSRFEVYFDALFGNFHDVRGIAFQSYQGFLSLADGSGLGVGLGQSRAKWFYLPEAKNDFIFAIIGEELGLWGGALVIALFAGLLYFGLRTAKKSHDPFLGLMAATLTASVVSQAFINIGYVVGLLPVTGIQLPMISAGGTSAIITLASMGLLISCARHEPETVSAMASYGRPAIDRLLGLREPSSTLTASNASLRSNKTKAARQKPSPQKESRDRFGEPVTARRAQAPRSGRAGVQSEAPRRSTGSVKGRSSGQDNGRGNEGTARSQSTTGGRAADRSVDRSRQSRPTERRSESRDDWRDNRNRR GT:EXON 1|1-550:0| BL:SWS:NREP 1 BL:SWS:REP 2->503|FTWH_MYCTU|3e-47|35.2|491/524| PROS 362->386|PS00428|FTSW_RODA_SPOVE|PDOC00352| TM:NTM 9 TM:REGION 42->64| TM:REGION 80->102| TM:REGION 107->129| TM:REGION 148->170| TM:REGION 188->210| TM:REGION 222->243| TM:REGION 308->330| TM:REGION 346->368| TM:REGION 380->402| SEG 107->121|nlsnlilivsivlll| SEG 206->243|fvlvvlfmlffagiamgwiaiagvliiaalavlalggg| SEG 534->549|errsesrddwrdnrnr| RP:PFM:NREP 2 RP:PFM:REP 45->403|PF01098|1e-47|34.2|351/357|FTSW_RODA_SPOVE| RP:PFM:REP 440->531|PF10243|4e-04|27.8|90/265|MIP-T3| HM:PFM:NREP 1 HM:PFM:REP 45->404|PF01098|8e-87|35.5|352/359|FTSW_RODA_SPOVE| GO:PFM:NREP 2 GO:PFM GO:0007049|"GO:cell cycle"|PF01098|IPR001182| GO:PFM GO:0016021|"GO:integral to membrane"|PF01098|IPR001182| OP:NHOMO 1382 OP:NHOMOORG 812 OP:PATTERN -------------------------------------------------------------------- 2211312211112112222-2211222222222222222223321111222222211211223-111433111111222333211222222221222--212222222232222222222222222122112222-33334---312212221122222222211112222121-21121-22-----222324333334444444544436642444333522244444433-22222222222222222212121--11222221111111122322111222212222222222222111111111111-22222222222342444444441413233333333323222222233221223333112122--1111111111111111--11111111111111-11111111111-111111111111111-11122222122222222222222211222--------1121112222222221111-2212222222111111-1111--1111111111111121111112222221222112222221111111122222222112211222111222211221211111222-11-1------1-1111111-1---22-1-1-11222221111122111221222121-11-1111-11111111111111111111-111111111111111111111122211111111111111111111111111121111111111111122-----222211-121112-222222122122222222221211111111-11111222---------133322222233122332222211122222-11111111111-11-122--------------------------2221111111221 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-27,403-551| PSIPRED cccccccccccccccccccccccHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEcccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //