[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55049.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->87 PF11239 * DUF3040 2e-07 39.0 %
:HMM:PFM   1->86 PF11239 * DUF3040 7.8e-28 51.9 81/82  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55049.1 GT:GENE BAF55049.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2260497..2260889) GB:FROM 2260497 GB:TO 2260889 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55049.1 LENGTH 130 SQ:AASEQ MSLSEQEQRALREIEQALMADDPKFGKAVASNNGLAGGGFTLRGIALFVLGLVLLVAGVALSQQTLWFVALGIIGFLVMFGSGVWMLRGGGSNKISVTSRTSNAKNRQQGNSTIGDKMEENFRRRFEGNK GT:EXON 1|1-130:0| TM:NTM 2 TM:REGION 40->62| TM:REGION 67->89| SEG 44->61|gialfvlglvllvagval| RP:PFM:NREP 1 RP:PFM:REP 1->87|PF11239|2e-07|39.0|82/82|DUF3040| HM:PFM:NREP 1 HM:PFM:REP 1->86|PF11239|7.8e-28|51.9|81/82|DUF3040| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -----111111-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,90-121,123-124,126-131| PSIPRED ccccHHHHHHHHHHHHHHHHccccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccc //