[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55058.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:436 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   95->265 PF09594 * DUF2029 5e-09 32.9 %
:HMM:PFM   93->341 PF09594 * DUF2029 1.3e-51 36.4 228/241  
:PROS 20->28|PS00221|MIP
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55058.1 GT:GENE BAF55058.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2270317..2271627 GB:FROM 2270317 GB:TO 2271627 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55058.1 LENGTH 436 SQ:AASEQ MTNPQTAHAAASDSASQKEAPNPSLSITVGIKDLLGLLSVLGIAAGLIANKILIERYNWRIDAAVYREGALALVNGQSLYAQPFDMGDISLPFIYPPIGAILFAPWGYFDFITVELAGNLVVIGSSLLLLLCLYLVTNAVLSGRDKLLAFTIAAISWPIALFAEPVFLNADLGQINILIMALVVMDLLPIKRRIPRGVLIGLAAAIKITPLAMLLYFLVKKDFRGIINAVISLLAFTAIGAVLAWENTKEFFSSTLLNLSAEGDSGVDTTFQSNSSIQAMLYRWWTSRADAEASSLPTILWIVLSLIAVAAVAYLMHQLFSRGLHVEAVMVNAMLMLLISPISWSHHWVWLPLWAVVFFVRYRQHRSHPKFLLWSGVILSVMLLMLPPKWWFGRDGVNVFELNFWEKLLISDWTWLSIGLMITLGLGLKAFPKIAK GT:EXON 1|1-436:0| PROS 20->28|PS00221|MIP|PDOC00193| TM:NTM 11 TM:REGION 27->49| TM:REGION 87->109| TM:REGION 116->138| TM:REGION 146->168| TM:REGION 170->190| TM:REGION 198->219| TM:REGION 225->246| TM:REGION 295->317| TM:REGION 324->346| TM:REGION 370->392| TM:REGION 410->432| SEG 120->141|lvvigsslllllclylvtnavl| SEG 299->313|ilwivlsliavaava| RP:PFM:NREP 1 RP:PFM:REP 95->265|PF09594|5e-09|32.9|164/236|DUF2029| HM:PFM:NREP 1 HM:PFM:REP 93->341|PF09594|1.3e-51|36.4|228/241|DUF2029| OP:NHOMO 64 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- ----221333312-11211-12111111111112122134---1---1------1--1------1121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-25,435-437| PSIPRED cccccccHHccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHcccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //