[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55062.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:483 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   129->416 1sfrC PDBj 9e-21 32.2 %
:RPS:PDB   135->331 3e4dD PDBj 3e-14 18.8 %
:RPS:SCOP  113->333 1pv1A  c.69.1.34 * 2e-16 17.3 %
:HMM:SCOP  116->418 1pv1A_ c.69.1.34 * 1.8e-21 21.5 %
:RPS:PFM   146->280 PF00756 * Esterase 2e-09 31.6 %
:HMM:PFM   136->406 PF00756 * Esterase 1.5e-26 29.6 230/252  
:BLT:SWISS 74->417 CSP1_CORML 9e-29 30.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55062.1 GT:GENE BAF55062.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2276363..2277814 GB:FROM 2276363 GB:TO 2277814 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55062.1 LENGTH 483 SQ:AASEQ MRKGISRVLSVAVASSIGFGSVLSGTGIAAAQDTEYDYGMDPNMNYNPIDDIKDRPEGLSNLPYFGSKLTSWGSSDATASSGVVTSALPQYTDPRYPLGKDDLPKATIDMEPEVLARLERFVGVDGDRIRQINAYSPSMGRTIPLVWVVPEDNTVPGPTVYALGGGDGGQGGQNWVTRTDLEELTSDNNINLIMPMLGSFSFYADWAGESESMGGAQQWETFLMHELPEPLEAAIGADGQRSIVGMSMSGGSVLNFATHDPNFYSSVGSFSGCAETNSWMGRRGIAATAYNGNVVPEQIFGEVDSDYSRYNDPLLNAAKLEEQDNLYIFAGSGVFSELDVIGDNAPIDEDAFKNRVLVGFEIEAMSNTCTHNLKAATDQMGIDNINYDFRPTGTHAWDYWNEALHRFFPLMMQGFGLDGGPIPVYNPNGISSSETSSELSSDVSLGTVIGSVAGSSGSSDGSSVREFLAGSSGSSQSAGSFYE GT:EXON 1|1-483:0| BL:SWS:NREP 1 BL:SWS:REP 74->417|CSP1_CORML|9e-29|30.2|328/657| SEG 164->173|gggdggqggq| SEG 244->253|vgmsmsggsv| SEG 431->464|sssetsselssdvslgtvigsvagssgssdgssv| SEG 469->480|agssgssqsags| BL:PDB:NREP 1 BL:PDB:REP 129->416|1sfrC|9e-21|32.2|270/278| RP:PDB:NREP 1 RP:PDB:REP 135->331|3e4dD|3e-14|18.8|176/265| RP:PFM:NREP 1 RP:PFM:REP 146->280|PF00756|2e-09|31.6|133/221|Esterase| HM:PFM:NREP 1 HM:PFM:REP 136->406|PF00756|1.5e-26|29.6|230/252|Esterase| RP:SCP:NREP 1 RP:SCP:REP 113->333|1pv1A|2e-16|17.3|197/290|c.69.1.34| HM:SCP:REP 116->418|1pv1A_|1.8e-21|21.5|261/0|c.69.1.34|1/1|alpha/beta-Hydrolases| OP:NHOMO 176 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- -----74566632343333-3544553333348454CECC-1--------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 286 STR:RPRED 59.2 SQ:SECSTR ################################################################################################################################cEEEEEEETTTTEEEEEEEEcGGGGTccEEEEEEEccTTcccHHccHHHHHcccHHHHHHTcEEEEcTcTTccTTccccccccTTGGGTccHHHHHTHHHHHHHHHccEEEEEEEEEcTHHHHHHHHHHHHcTTTccccEEEcccccGGcTTTHHHHHHHHHTTHHHHHHHHcccTTTTGGGcHHHHHHTTccccEEEEEEEEcccccTTc##cccHHHHcccccGHHHHHHHHHHHHHHHHHHHHHHHHHTTcccEEEEccccccccHHHHHHHHHHTHHHHHHHHc################################################################### DISOP:02AL 1-5,73-76,79-81,483-484| PSIPRED ccHHHHHHHHHHHHHHHcHHHHHccccccccccccccccccccccccccHHHHHccccccccccccHHccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEEEEEccccccEEEEEEEEcccccccccEEEEEccccccccccHHHHHccHHHHHHHcccEEEEEcccccccccccccccccccHHccHHHHHHHHHHHHHHHHcccccccEEEEEcHHHHHHHHHHHHcccccHHHHHcccccccccccHHHHHHHHHHcccccHHHHccccccHHHHHHcHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHcccHHHHHccccccccccHHHHHHccccccccccccccc //