[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55075.1
DDBJ      :             hypothetical protein
Swiss-Prot:COX4_CORGL   RecName: Full=Cytochrome c oxidase polypeptide 4;         EC=1.9.3.1;AltName: Full=Cytochrome c oxidase polypeptide IV;AltName: Full=Cytochrome aa3 subunit 4;

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->143 PF12270 * Cyt_c_ox_IV 2e-26 53.7 %
:HMM:PFM   1->143 PF12270 * Cyt_c_ox_IV 1.9e-55 48.9 137/137  
:BLT:SWISS 1->143 COX4_CORGL 6e-77 95.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55075.1 GT:GENE BAF55075.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2290479..2290910) GB:FROM 2290479 GB:TO 2290910 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55075.1 LENGTH 143 SQ:AASEQ MKSSAKLMYGLTVFMVAMAVIYIFATMHVNDGGSVPGVEWVGATALVLSAGLTLMLGVYLHFTEVRVDVLPEDWEEAEVADKAGTLGFFSPSSIWPAAMSGAVGFLAFGVVYFHYWMIAVGLMLLIFTITKLNLQYGVPKEKH GT:EXON 1|1-143:0| SW:ID COX4_CORGL SW:DE RecName: Full=Cytochrome c oxidase polypeptide 4; EC=1.9.3.1;AltName: Full=Cytochrome c oxidase polypeptide IV;AltName: Full=Cytochrome aa3 subunit 4; SW:GN Name=ctaF; OrderedLocusNames=Cgl2194, cg2408; SW:KW Cell membrane; Complete proteome; Membrane; Oxidoreductase;Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->143|COX4_CORGL|6e-77|95.8|143/143| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 6->28| TM:REGION 40->61| TM:REGION 105->127| RP:PFM:NREP 1 RP:PFM:REP 1->143|PF12270|2e-26|53.7|134/134|Cyt_c_ox_IV| HM:PFM:NREP 1 HM:PFM:REP 1->143|PF12270|1.9e-55|48.9|137/137|Cyt_c_ox_IV| OP:NHOMO 48 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-111111111111111111111-1---1-1-------1---1-11-1-1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,139-144| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHEEEEEcccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccccEEEccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccccc //