[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55080.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  416/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:174 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->172 1c9kB PDBj 1e-21 41.6 %
:RPS:PDB   4->172 1c9kC PDBj 7e-08 30.4 %
:RPS:SCOP  3->172 1c9kA  c.37.1.11 * 2e-44 40.1 %
:HMM:SCOP  1->172 1cbuA_ c.37.1.11 * 4.4e-37 50.0 %
:RPS:PFM   3->171 PF02283 * CobU 1e-31 54.6 %
:HMM:PFM   3->171 PF02283 * CobU 1.3e-52 48.5 163/167  
:BLT:SWISS 4->172 COBP_PSEDE 1e-22 47.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55080.1 GT:GENE BAF55080.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2295984..2296508 GB:FROM 2295984 GB:TO 2296508 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55080.1 LENGTH 174 SQ:AASEQ MRTLVLGGARSGKSAFAESLVGCGPVLYVATARPSGDDPEFAERIAVHAARRPTSWVLDEEGDVDKLLASPPAIPVLVDDLGTWLTHATDACDGWEASSAQLEAKMDLLIDAILHFQGADLVIVSPEVGMGIVPEYKSGRLFRDRIGTLNQRVAAICERVVFVVAGLPLELKTF GT:EXON 1|1-174:0| BL:SWS:NREP 1 BL:SWS:REP 4->172|COBP_PSEDE|1e-22|47.2|159/174| BL:PDB:NREP 1 BL:PDB:REP 4->172|1c9kB|1e-21|41.6|166/180| RP:PDB:NREP 1 RP:PDB:REP 4->172|1c9kC|7e-08|30.4|161/165| RP:PFM:NREP 1 RP:PFM:REP 3->171|PF02283|1e-31|54.6|163/167|CobU| HM:PFM:NREP 1 HM:PFM:REP 3->171|PF02283|1.3e-52|48.5|163/167|CobU| GO:PFM:NREP 4 GO:PFM GO:0000166|"GO:nucleotide binding"|PF02283|IPR003203| GO:PFM GO:0043752|"GO:adenosylcobinamide kinase activity"|PF02283|IPR003203| GO:PFM GO:0043753|"GO:adenosylcobinamide-phosphate guanylyltransferase activity"|PF02283|IPR003203| GO:PFM GO:0051188|"GO:cofactor biosynthetic process"|PF02283|IPR003203| RP:SCP:NREP 1 RP:SCP:REP 3->172|1c9kA|2e-44|40.1|162/170|c.37.1.11| HM:SCP:REP 1->172|1cbuA_|4.4e-37|50.0|168/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 421 OP:NHOMOORG 416 OP:PATTERN -------------------------------------------------------------------- ----1-11111-1-11111-11--11111111111112111111----------------1-111111111-----------1-----11-1-111-----11--1-1-----------------1111111111111111112--1111111111111111-1111111111111111111111111-------------------------------------11111121---------------------------------11---------------------------------------------1----------111-1111111---1-11-----11--1--1-11111--111111---111----------1-111---1111111111111111-1-1--1-1-1--11111-1--1111111-1-1111111111111111-11-11-1-------------------------------1--------111111-111111111111111111111--111121111111--111-11111----------111-1111-11--1111-111111111-----1-1-----------------------------1-111-11-11111-1111111111121----11-------1---1--1111111111--11111111111111111-111--11-1111111111111111---11-11--1------------------------111-1---------------111111-----1----1----1111--11-------------11111111111--11111111------1---1111------------------------------------11-1--------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 169 STR:RPRED 97.1 SQ:SECSTR ###EEEEcTTccHHHHHHHHHccccEEEEEEcccEEEEEccccccHHHHccTTcEEcccGGGTccTTcccccEEEEEcHHHHHHHHHHHHccTTcccHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEETTEEEEcc## PSIPRED ccEEEEccccccHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHcccccEEEEccHHHHHHHcccccEEEEEcHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEccEEEcccc //