[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55092.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->150 PF06271 * RDD 1e-12 18.9 106/133  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55092.1 GT:GENE BAF55092.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2310442..2310915) GB:FROM 2310442 GB:TO 2310915 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55092.1 LENGTH 157 SQ:AASEQ MAKPKRSWLDGPEIPADFDDPDAPGRWPGEKLGLPQEGAGSLSSVARRIGGVCVDWGVSWVIAIVLSNFTDVLGDVATSTLIIFVILGWLTGWIFARTPGHAVFGMGLARVDAEERVGWWRALVRPLLTILILPAVMVDADGRGLHDKATGTAVIRG GT:EXON 1|1-157:0| TM:NTM 3 TM:REGION 50->72| TM:REGION 74->96| TM:REGION 119->141| HM:PFM:NREP 1 HM:PFM:REP 43->150|PF06271|1e-12|18.9|106/133|RDD| OP:NHOMO 45 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- ----1111111111-1111-11--1111111111111111----1--1-11111-1-1-----1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEccccccccccccccEEEEEEEEEEcccccccHHHHHHHHHHHHHEEccEEEccccccHHHHHHEEEEEcc //