[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55097.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  141/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.1.16
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->282 2b81C PDBj 2e-29 35.0 %
:RPS:PDB   6->283 2b81C PDBj 1e-37 33.1 %
:RPS:SCOP  17->208 1ezwA  c.1.16.3 * 3e-27 20.9 %
:HMM:SCOP  15->285 1rhcA_ c.1.16.3 * 1.2e-49 33.3 %
:RPS:PFM   20->190 PF00296 * Bac_luciferase 1e-19 41.0 %
:HMM:PFM   10->208 PF00296 * Bac_luciferase 3.4e-43 35.1 185/307  
:BLT:SWISS 26->275 Y978_MYCBO 2e-18 32.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55097.1 GT:GENE BAF55097.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2314347..2315198 GB:FROM 2314347 GB:TO 2315198 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55097.1 LENGTH 283 SQ:AASEQ MTPNGPELGRSEMVPTENSIELAIQAEAQGFRGMWVRDVPLAVPQGITVADKQATYLDDPFLMLGAMASVTSTIALGTAATVLPLRHPLHVAKSALTLDRLSHGRFVLGIGSGDRPEEFEIFGKSSDNRRADIQSGWAILRAALSPDPAMRADLEFAPTTPPEAQIPMIAVGSARQTVQWIARNADGWATYYRPAEAQVGRLDLWDKARGGTRPLLISSMGLNLTEGNTHKEITLGVEVGSQELIEHLHRLSELGIDHVIFNIQRRPASEVLTQIYEEVLPHL GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 26->275|Y978_MYCBO|2e-18|32.8|229/282| BL:PDB:NREP 1 BL:PDB:REP 15->282|2b81C|2e-29|35.0|260/310| RP:PDB:NREP 1 RP:PDB:REP 6->283|2b81C|1e-37|33.1|272/310| RP:PFM:NREP 1 RP:PFM:REP 20->190|PF00296|1e-19|41.0|161/296|Bac_luciferase| HM:PFM:NREP 1 HM:PFM:REP 10->208|PF00296|3.4e-43|35.1|185/307|Bac_luciferase| RP:SCP:NREP 1 RP:SCP:REP 17->208|1ezwA|3e-27|20.9|177/347|c.1.16.3| HM:SCP:REP 15->285|1rhcA_|1.2e-49|33.3|258/0|c.1.16.3|1/1|Bacterial luciferase-like| OP:NHOMO 275 OP:NHOMOORG 148 OP:PATTERN -----------------------12-----1-----------------------------------11 ----5--2111--137611-19--78111116477744611916111-----2-1-----212-1323231-----------2-----------------1--------------------------------------1-----21--------------------111------------------------111111-1--11--1------1--2-----1------1----------------1--11--------------------------------------------------------------------------------------------------------------------------11--------1-2-111----2----------------1----11--3112--1-----1------1----------------11-------------------------------------2---1--2222222-----2222------121-1------1------------------------------------------------------------------------------------------11---1-----------------------------------------11---------------------------------1121112-----------------1------------------------------------------------------------------1111---1111111112-------------------1----22----------------------------------------------------------------------- -------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 100.0 SQ:SECSTR EEccccccccTTccccTTHHHHHHHHHHHTccEEEEcccccccTTTccTcccTTTTTccccHHHHHHHTTccccEEEEEEEETTTccHHHHHHHHHHHHHHcTTcEEEEEEccccHHHHHHHTcccTTHHHHHHHHHHHHHHHHHccccTTEEEEcccccccccccccEEEEccTTccHHHHHccccEcccccHHHHHHHHHHHHHHHHHHcTTccccEEEEEEEEcccTTcETTEEEEcHHHHHHHHHHHHHTTccEEEEEcTcccHHHHHHHHHHHTGGGc DISOP:02AL 1-2| PSIPRED cccccccccccccccHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccccccEEEEcccHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHccccccEEEEEEEEEEccccHHHHHHHHHHccHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHcccc //