[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55102.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:446 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   276->428 2v8nA PDBj 5e-06 27.0 %
:RPS:SCOP  276->397 1pv6A  f.38.1.2 * 3e-07 19.8 %
:HMM:SCOP  18->441 1pw4A_ f.38.1.1 * 3.4e-48 20.7 %
:RPS:PFM   69->354 PF07690 * MFS_1 3e-04 21.3 %
:HMM:PFM   43->358 PF07690 * MFS_1 3.1e-27 24.4 311/353  
:BLT:SWISS 39->432 GUDP_ECOLI 3e-10 20.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55102.1 GT:GENE BAF55102.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2319231..2320571 GB:FROM 2319231 GB:TO 2320571 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55102.1 LENGTH 446 SQ:AASEQ MGRAADYSPRLGLPRTFKDRVKPVGVEKVKVSAKALVVWLTAMCVYIVAIAGRTSFGVAGVHAIDRFDIDASRLAVFTSVQVGVYALAQIPMGMLVDRFDARKLLLAGALILAAGQLILGFTDSYMIAIFARVLIGVGDSSAFLSVMRLLPNWFPMSWTPVLQQLTGAFGFVGQFFSAVPFLHMLNTLGWTIPFASLGAVGIIVAIAAAILVRDAPASSEPVRRGEASISIAFRLKSVLTSLYCWQGVFNHWVSMGPVMVFLLLWGTPTLTLGLGISSGEVGTVLTIFAVATVITGPLSGIVSSRLGTRRGMIGFVTPMIQAALWIVLFLFADRLSNPLVFVSAIMFAISFSSPVANFGFDTIREKLDRRVMVAGTGMANMGAYICAMLATQIIGFLLDWNADGHAYTWSNFQVAWLGLGVVWLAGMIGLAVCLLLQRRKNIAFRR GT:EXON 1|1-446:0| BL:SWS:NREP 1 BL:SWS:REP 39->432|GUDP_ECOLI|3e-10|20.8|380/450| TM:NTM 12 TM:REGION 31->53| TM:REGION 73->95| TM:REGION 104->126| TM:REGION 128->150| TM:REGION 163->185| TM:REGION 194->216| TM:REGION 254->276| TM:REGION 280->302| TM:REGION 311->333| TM:REGION 336->358| TM:REGION 377->399| TM:REGION 414->436| SEG 104->120|lllagalilaagqlilg| SEG 198->210|gavgiivaiaaai| SEG 262->275|lllwgtptltlglg| BL:PDB:NREP 1 BL:PDB:REP 276->428|2v8nA|5e-06|27.0|141/417| RP:PFM:NREP 1 RP:PFM:REP 69->354|PF07690|3e-04|21.3|282/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 43->358|PF07690|3.1e-27|24.4|311/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 276->397|1pv6A|3e-07|19.8|121/417|f.38.1.2| HM:SCP:REP 18->441|1pw4A_|3.4e-48|20.7|410/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 131 OP:NHOMOORG 75 OP:PATTERN -----------------------1-------1------111---------1----------------- --1--1-14421-1-------1---1------1111-111----1-1111111111-1----111121111------------------------------------------------------------------------------------------------------------------------1-----------------------------1------------------------------------------------------------------------------------------------------1--------------1-------------------11--1------1------------------2-------------------------1-1-------------------------------------------------------------------------1--------------------------------------1------1-------------21-----------------1--11---------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------43434A999--------------------------------------------1----1------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 31.6 SQ:SECSTR ###################################################################################################################################################################################################################################################################################ccHHHHTTHHHHHHHHHHTTHHHHHHHHTcccccccTHHHHHHHHTTcTTTTTTTHHHHHTTcHHHHTTGGGTTTTTTTHH##HHHHHHHHHHHHHccc#cTTTcTTTTHHHHHHHHHHTTH#########HHHcHHHHHHHHHHTTHHHHHH################## DISOP:02AL 1-11,15-15,442-447| PSIPRED ccccHHHHHHcccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //