[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55103.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y2226_CORGL  RecName: Full=Uncharacterized protein Cgl2226/cg2444;         Short=P24;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->120 Y2226_CORGL 5e-56 99.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55103.1 GT:GENE BAF55103.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2320588..2321070) GB:FROM 2320588 GB:TO 2321070 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55103.1 LENGTH 160 SQ:AASEQ MAIKLSIDLSDATFAELSAVIGYAHQLGVDADEKLTFEGTVLNIEFDGDLQFDDVFDAFDEAEIELDNPREDGPIYADDLIDEDEDYRAQTKSPINDEVINEIRDGISSFVDGIVNGLGQGRRGGRYGDFGGPRGPRGPRNDGPFGPFGPFGPGYRGPRF GT:EXON 1|1-160:0| SW:ID Y2226_CORGL SW:DE RecName: Full=Uncharacterized protein Cgl2226/cg2444; Short=P24; SW:GN OrderedLocusNames=Cgl2226, cg2444; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->120|Y2226_CORGL|5e-56|99.2|120/100| SEG 52->63|fddvfdafdeae| SEG 121->159|grrggrygdfggprgprgprndgpfgpfgpfgpgyrgpr| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,88-97,159-161| PSIPRED ccEEEEEEcccHHHHHHHHHHHHHHHHcccHHHcEEEEEEEEEEEEcccccHHHHHHHHHHHHHHcccccccccEEHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc //