[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55112.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->84 PF10513 * EPL1 0.00014 28.3 53/160  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55112.1 GT:GENE BAF55112.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2333123..2333440 GB:FROM 2333123 GB:TO 2333440 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55112.1 LENGTH 105 SQ:AASEQ MISAGLLIKYSPHSRGQTFKSNIFLHSNDPNLQKSTTIGQVKAICGVYSHIHSTPGMPKEEHSIPQQPEHQKHKEKGANEPTYKPDSVPVAKATGGDHPSRRSHC GT:EXON 1|1-105:0| HM:PFM:NREP 1 HM:PFM:REP 21->84|PF10513|0.00014|28.3|53/160|EPL1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,55-84,94-106| PSIPRED ccccEEEEEcccccccccHHccEEEEcccccccccccccHHHHHHHHHHHHHcccccccHHccccccHHHHHHHHHccccccccccccccccccccccccHHccc //