[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55116.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  428/915 : Eukaryota  3/199 : Viruses  1/175   --->[See Alignment]
c.108.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->196 2ah5A PDBj 2e-15 31.7 %
:RPS:PDB   7->210 3d6jA PDBj 7e-28 20.8 %
:RPS:SCOP  7->214 2hszA1  c.108.1.6 * 1e-40 24.2 %
:HMM:SCOP  5->219 2hcfA1 c.108.1.6 * 8.7e-42 31.0 %
:RPS:PFM   60->103 PF01017 * STAT_alpha 2e-04 31.8 %
:HMM:PFM   7->175 PF00702 * Hydrolase 7.2e-15 22.2 167/192  
:BLT:SWISS 5->206 Y2257_MYCBO 1e-35 39.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55116.1 GT:GENE BAF55116.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2336975..2337631 GB:FROM 2336975 GB:TO 2337631 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55116.1 LENGTH 218 SQ:AASEQ MTTPSKKTLLFDLDGTLVDSFPGIRTSFLHTLHEKNWEIPSEERISQVPGPPMEWTFQDLGMTPEQAQDALQTYLEHYGQVGWDLSEAFPGMRDLLIRLKYEGFRLCTATSKGEFFAEKVLRKFEMFDLFEFMGAATDNGNRRSKSAVIKHVLDSVGLDEPNDILMIGDRSHDIEGSSEFGIDCVAVTWGYGSKTEWDAARYTVSTAEELERIIHDWA GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 5->206|Y2257_MYCBO|1e-35|39.5|200/291| BL:PDB:NREP 1 BL:PDB:REP 9->196|2ah5A|2e-15|31.7|180/206| RP:PDB:NREP 1 RP:PDB:REP 7->210|3d6jA|7e-28|20.8|202/206| RP:PFM:NREP 1 RP:PFM:REP 60->103|PF01017|2e-04|31.8|44/181|STAT_alpha| HM:PFM:NREP 1 HM:PFM:REP 7->175|PF00702|7.2e-15|22.2|167/192|Hydrolase| GO:PFM:NREP 5 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01017|IPR013800| GO:PFM GO:0004871|"GO:signal transducer activity"|PF01017|IPR013800| GO:PFM GO:0005634|"GO:nucleus"|PF01017|IPR013800| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01017|IPR013800| GO:PFM GO:0007165|"GO:signal transduction"|PF01017|IPR013800| RP:SCP:NREP 1 RP:SCP:REP 7->214|2hszA1|1e-40|24.2|207/224|c.108.1.6| HM:SCP:REP 5->219|2hcfA1|8.7e-42|31.0|210/0|c.108.1.6|1/1|HAD-like| OP:NHOMO 559 OP:NHOMOORG 434 OP:PATTERN ---------------------------------1-----------1---------------------- --2---111111-111111-11--111111111111-111-----11-11111121-111-----------11111112---11-11-2211-2-------1-----------------------1--121--1-1111-----1-1-------------------111--------------1--------1-33333234142323211--113421111111-------2--------------------1---11---------111-----------111111111111111111-------------1111111111---11-------1-11111-1112--1211111--111-1-1-111----11----------1-3111-1---1--------1--1------1--11--2--1111-1-----11--------1--11111111111--111-----------------------------------11111-------------11--------2--1-11--1-2-11-11--1--1211--1221-1-------1-11-21--1------111-1--12-1--12--2-111111111---------212-2--12122-12--22111122211112122122---2112------1-221-11111111111-1111111111111111111---1111--1-1----1--1111-21111111-----------------111111-------121111111111111114444433123--33333224333321111---------1111-11111111111111111111------11--11----------1--------------------------------1-1-1--3 -----------1-----------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1---- --1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 100.0 SQ:SECSTR cccccccEEEEcccTTTEEcHHHHHHHHHHHHHHTTcccccHHHHTTTTccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHGGGcEEcTTHHHHHHHHHHHTcEEEEEccccHHHHHHHHHHTccTTcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGGEEEEEccHHHHHHHHHHTcEEEEETTcccTTGGGGcccEEEccGGGGHHHHccGG DISOP:02AL 1-3| PSIPRED cccccccEEEEEccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHcccHHHccEEEcHHHcccccccHHHHHHHHHHcccccHHHEEEEcccHHHHHHHHHcccEEEEEccccccHHHHHcccEEEccHHHHHHHHHHHc //