[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55125.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  234/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:330 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->327 2qh8A PDBj 4e-47 37.6 %
:RPS:PDB   43->327 3c6qB PDBj 9e-11 13.3 %
:RPS:SCOP  42->299 1bykA  c.93.1.1 * 2e-07 11.1 %
:HMM:SCOP  41->293 1rpjA_ c.93.1.1 * 6.9e-13 17.9 %
:RPS:PFM   55->327 PF04392 * ABC_sub_bind 1e-53 46.0 %
:HMM:PFM   43->329 PF04392 * ABC_sub_bind 1.6e-85 42.0 286/294  
:BLT:SWISS 43->317 Y367_RICPR 6e-16 25.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55125.1 GT:GENE BAF55125.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2345502..2346494) GB:FROM 2345502 GB:TO 2346494 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55125.1 LENGTH 330 SQ:AASEQ MFSSRSKVLASIFTVGALALASCSSDSSDSSTSTDAAGGDSYRVGINQLVQHPALDAATTGFKEAFEEAGVDVTFDEQNANGEQGTALTISQQFASDNLDLVLAVATPAAQATAQNITDIPVLFTAVTDAVSAELVDSNEAPGGNVTGTSDIAPIEQQLELLQQLVPDAKSIGIVYASGEVNSQVQVDEVTKAAEPLGLSVNTQTVTTVNEIQQAVEALGDVDVIYVPTDNMVVSGISSLVQVAEQKQIPVIGAESGTVEGGALATLGIDYTELGRQTGEMALRILQDGEDPATMPVETATEFTYVINEDAAERQGVEIPQEILDKAERV GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 43->317|Y367_RICPR|6e-16|25.6|258/303| SEG 17->41|alalascssdssdsststdaaggds| SEG 101->115|lvlavatpaaqataq| SEG 156->165|eqqlellqql| BL:PDB:NREP 1 BL:PDB:REP 43->327|2qh8A|4e-47|37.6|282/294| RP:PDB:NREP 1 RP:PDB:REP 43->327|3c6qB|9e-11|13.3|270/305| RP:PFM:NREP 1 RP:PFM:REP 55->327|PF04392|1e-53|46.0|272/279|ABC_sub_bind| HM:PFM:NREP 1 HM:PFM:REP 43->329|PF04392|1.6e-85|42.0|286/294|ABC_sub_bind| RP:SCP:NREP 1 RP:SCP:REP 42->299|1bykA|2e-07|11.1|244/255|c.93.1.1| HM:SCP:REP 41->293|1rpjA_|6.9e-13|17.9|252/288|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 330 OP:NHOMOORG 234 OP:PATTERN -------------------------------------------------------------------- -----1-1111------------------------------1-------------11-----------------------------------------------------------------------------1---------------------------------------------------------1----------------1--------1221---------31--------------------112133-1111222233111111---22213332111111111112111111111111111332223333--3-22222222-21-211-------1-1-2--54-3-11-1------13-------111-1--1-1--------11111111111---7----111--111-11-2111111--------------------------1-1------------1111-11--1111----------11111-1111--1111111-1111111-41131--1111-1111--1----1-----1-----------1---1-111---3---12122342---------1-------------------------------1-----1----------------------------------------------------------------------------------------------------------------------------------1-------------1----------222--1111--------------------------11111111211-----------------3-------------------------------------------11---1----1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 288 STR:RPRED 87.3 SQ:SECSTR #########################################cEEEEEcccccTHHHHHHHHHHHHHHHHTcEEEEEcccccccHHHHHHHHHHHHHHTccEEEEccccTTTTHHHHHHTHHHHHHHHHTTccEEEEccccTTccccEEccHHHHHHHHHHHHHHHHTTccEEEEEEcccccHHHHHHHHHHHHHTTcccEEEEEEEccHHHHHHHHHHHTTccEEEEccTTHHHHHHHHHHHTTccTTcEEEEEcccHHTTcccEEEEEcHHHHHHHHHHHHHHHHHTcHHHHHTTccEccEEEEETTEEEEETTcEEccEEEEcTTHH# DISOP:02AL 1-4,26-42| PSIPRED cccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHcccccEEEEEcccHHHccccccHHHccccEEEEEccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHccccEEEccHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHccccHHHcccccccccEEEEcHHHHHHccccccHHHHHHcccc //