[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55134.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   67->109 PF11795 * DUF3322 0.00082 20.0 40/190  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55134.1 GT:GENE BAF55134.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2353102..2353560) GB:FROM 2353102 GB:TO 2353560 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55134.1 LENGTH 152 SQ:AASEQ MNQANLPAEIADLSDETALWEIINEYNWDDGFAVPLAVVRHSKCDRALALRLFWDIDETAQTHHSDEESAIAELYASTAENDPAEFDRIMDYCTTLVEGLRKQTYPRGANRFDTGFFNLEDPSLTDRQRKIRAGKTKFALKNFEEAFLQPEL GT:EXON 1|1-152:0| HM:PFM:NREP 1 HM:PFM:REP 67->109|PF11795|0.00082|20.0|40/190|DUF3322| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,152-153| PSIPRED cccccccHHHHHcccHHHHHHHHHHcccccccEEcHHHHccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHcccc //