[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55138.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   54->89 PF02093 * Gag_p30 0.00095 30.6 36/211  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55138.1 GT:GENE BAF55138.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2356693..2357037 GB:FROM 2356693 GB:TO 2357037 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55138.1 LENGTH 114 SQ:AASEQ MSDSPRVIVILDRTTTAPSILRDAKTLTGYGLSEIRSRIVAGLPVVIEEMFSNAWYDERAQLLLALLTKWQNESVVFEVREVAENDDTEAGALISLEVLRNIIESDDNESRDGI GT:EXON 1|1-114:0| HM:PFM:NREP 1 HM:PFM:REP 54->89|PF02093|0.00095|30.6|36/211|Gag_p30| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,106-115| PSIPRED cccccEEEEEEEccccHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHcccccccccHHHHHHHHHHHcccccccccccc //