[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55143.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  89/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.1.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->149 1gmpA PDBj 8e-19 51.1 %
:RPS:PDB   52->150 1ay7A PDBj 3e-30 50.5 %
:RPS:SCOP  52->150 1ay7A  d.1.1.2 * 2e-30 50.5 %
:HMM:SCOP  46->150 1a2pA_ d.1.1.2 * 3.5e-33 52.0 %
:HMM:PFM   63->149 PF00545 * Ribonuclease 1.1e-25 42.2 83/83  
:HMM:PFM   4->47 PF06525 * SoxE 0.00073 31.8 44/195  
:BLT:SWISS 61->146 RNS3_STRAU 1e-17 54.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55143.1 GT:GENE BAF55143.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2363473..2363937 GB:FROM 2363473 GB:TO 2363937 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55143.1 LENGTH 154 SQ:AASEQ MLGVIVVLAAAWFGIDLSTSGEATSQASSSATTTTITSSNTPTSESISSNSDLNGDSCSMSELPQEADEVVDDILAGGPFDYPDNDGVRFGNYEGVLPKESSNYYREYTVETPGLSHRGPLRIVTGGSNPTDPEVWYYTSDHYETFCAITDAEN GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 61->146|RNS3_STRAU|1e-17|54.3|81/141| TM:NTM 1 TM:REGION 1->21| SEG 18->51|stsgeatsqasssattttitssntptsesissns| BL:PDB:NREP 1 BL:PDB:REP 52->149|1gmpA|8e-19|51.1|92/96| RP:PDB:NREP 1 RP:PDB:REP 52->150|1ay7A|3e-30|50.5|93/96| HM:PFM:NREP 2 HM:PFM:REP 63->149|PF00545|1.1e-25|42.2|83/83|Ribonuclease| HM:PFM:REP 4->47|PF06525|0.00073|31.8|44/195|SoxE| RP:SCP:NREP 1 RP:SCP:REP 52->150|1ay7A|2e-30|50.5|93/96|d.1.1.2| HM:SCP:REP 46->150|1a2pA_|3.5e-33|52.0|98/108|d.1.1.2|1/1|Microbial ribonucleases| OP:NHOMO 96 OP:NHOMOORG 89 OP:PATTERN -------------------------------------------------------------------- ----11111112111----------1---------------------1----111--1-----11-22-1--------------------------------------------------------------------------1--------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111221111111121211--111111111-1111111----------------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------11111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 66.2 SQ:SECSTR ###################################################ccccEEEEGGGccHHHHHHHHHHHTTcccccTTTTTcccccTTcccccccTTccEEEEcccTTcccccccEEEEcccTTcETccEEEEccTTcccEEEEccc# DISOP:02AL 23-50,151-155| PSIPRED cHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHHHHHHHccccccccccccEEEEcccccccccccEEEEEEccccccccccccEEEEccccccccccEEEccHHHHHHHHcccccc //