[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55147.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  80/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   37->167 PF02698 * DUF218 5e-12 33.6 %
:HMM:PFM   37->179 PF02698 * DUF218 2.7e-27 33.6 143/155  
:BLT:SWISS 40->157 SANA_SHIFL 8e-05 32.5 %
:PROS 1->44|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55147.1 GT:GENE BAF55147.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2368379..2369056) GB:FROM 2368379 GB:TO 2369056 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55147.1 LENGTH 225 SQ:AASEQ MRRFLAKSLLLTAVVQPALRVVAYSMLRTPNNRHRIDSILVLGTAQYDGVPSRQFAARLRHAAKLWRLHEIQHVYTVGGKLPGDRFTEAEVAREYLIKEGVDPDLIFASAVGNDTVSSYEALDPEKLGRVLIVTDPNHSYRAVRIARRMGFDAKPSPTTYSPAKFPSIVYFLTLSHEWGGVVVQDVSWLLGERVADKVEASLRTIQGLLRPSRRARHEQLRRLKK GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 40->157|SANA_SHIFL|8e-05|32.5|114/239| PROS 1->44|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| RP:PFM:NREP 1 RP:PFM:REP 37->167|PF02698|5e-12|33.6|131/150|DUF218| HM:PFM:NREP 1 HM:PFM:REP 37->179|PF02698|2.7e-27|33.6|143/155|DUF218| OP:NHOMO 81 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- 111---1111111-----------------------1111-111--------------------111---1-------------------------------------------------------------------------11---------------------11--------------1--11------111111111111111------111--------111-1--------------------------------------------------------------------------------------------1--------------1------------------------1--1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1-1-11111-1-1--1------------------------------------------------------------------------------------------------------------11111111111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 216-226| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHccccHHHEEEccccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHc //