[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55151.1
DDBJ      :             hypothetical protein
Swiss-Prot:SYG_CORGL    RecName: Full=Glycyl-tRNA synthetase;         EC=6.1.1.14;AltName: Full=Glycine--tRNA ligase;         Short=GlyRS;

Homologs  Archaea  68/68 : Bacteria  240/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.51.1d.104.1
:461 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->458 1b76A PDBj e-106 50.4 %
:RPS:PDB   7->458 1atiA PDBj 5e-57 51.5 %
:RPS:SCOP  8->340 1g5hA2  d.104.1.1 * 2e-98 23.6 %
:RPS:SCOP  354->458 1g5hA1  c.51.1.1 * 2e-23 28.6 %
:HMM:SCOP  3->370 1atiA2 d.104.1.1 * 7.4e-119 43.5 %
:HMM:SCOP  354->458 1g5hA1 c.51.1.1 * 8.2e-34 61.9 %
:RPS:PFM   159->270 PF00587 * tRNA-synt_2b 3e-19 45.9 %
:RPS:PFM   368->454 PF03129 * HGTP_anticodon 2e-14 50.0 %
:HMM:PFM   43->273 PF00587 * tRNA-synt_2b 4.6e-59 40.2 169/173  
:HMM:PFM   367->456 PF03129 * HGTP_anticodon 2.8e-27 47.8 90/94  
:BLT:SWISS 1->461 SYG_CORGL 0.0 100.0 %
:PROS 420->426|PS00307|LECTIN_LEGUME_BETA

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55151.1 GT:GENE BAF55151.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2372604..2373989) GB:FROM 2372604 GB:TO 2373989 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55151.1 LENGTH 461 SQ:AASEQ MAQQSIIDTVVNLCKRRGLVYPCGEIYGGTRSAWDYGPLGVELKENIKRQWWRSMVTSRPDVVGVDTSVILPRQVWVTSGHVEVFTDPLVESLNTHKRYRADHLLEQYEEKHGHPPVNGLADINDPETGQPGNWTEPKAFSGLLKTFLGPVDDEEGLHYLRPETAQGIFVNFKNVMNTSRMKPPFGIANIGKSFRNEITPGNFIFRTREFEQMEMEFFVKPGEDEEWHQHWIDTRLQWYINLGIKPENLRLYEHPQEKLSHYSKRTVDIEYAFNFANTKWGELEGIANRTDYDLRVHSEGSGEDLSFFDQETNERWIPFVIEPAAGLGRAMMMFLMDAYHEDEAPNSKGGVDKRVVLKLDRRLAPVKVAVLPLSKKDTLTPLAEKLAAELREFWNVDYDTSGAIGRRYRRQDEIGTPFCVTVDFDSLEDNAVTVRERDTMEQVRVPLDELQGYLAQRLIGC GT:EXON 1|1-461:0| SW:ID SYG_CORGL SW:DE RecName: Full=Glycyl-tRNA synthetase; EC=6.1.1.14;AltName: Full=Glycine--tRNA ligase; Short=GlyRS; SW:GN Name=glyQS; Synonyms=glyS; OrderedLocusNames=Cgl2278, cg2499; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->461|SYG_CORGL|0.0|100.0|461/461| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 420->426|PS00307|LECTIN_LEGUME_BETA|PDOC00278| BL:PDB:NREP 1 BL:PDB:REP 5->458|1b76A|e-106|50.4|411/442| RP:PDB:NREP 1 RP:PDB:REP 7->458|1atiA|5e-57|51.5|404/437| RP:PFM:NREP 2 RP:PFM:REP 159->270|PF00587|3e-19|45.9|109/170|tRNA-synt_2b| RP:PFM:REP 368->454|PF03129|2e-14|50.0|84/91|HGTP_anticodon| HM:PFM:NREP 2 HM:PFM:REP 43->273|PF00587|4.6e-59|40.2|169/173|tRNA-synt_2b| HM:PFM:REP 367->456|PF03129|2.8e-27|47.8|90/94|HGTP_anticodon| GO:PFM:NREP 9 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00587|IPR002314| GO:PFM GO:0005524|"GO:ATP binding"|PF00587|IPR002314| GO:PFM GO:0005737|"GO:cytoplasm"|PF00587|IPR002314| GO:PFM GO:0006412|"GO:translation"|PF00587|IPR002314| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF03129|IPR004154| GO:PFM GO:0005524|"GO:ATP binding"|PF03129|IPR004154| GO:PFM GO:0006412|"GO:translation"|PF03129|IPR004154| RP:SCP:NREP 2 RP:SCP:REP 8->340|1g5hA2|2e-98|23.6|271/278|d.104.1.1| RP:SCP:REP 354->458|1g5hA1|2e-23|28.6|105/127|c.51.1.1| HM:SCP:REP 3->370|1atiA2|7.4e-119|43.5|352/394|d.104.1.1|1/1|Class II aaRS and biotin synthetases| HM:SCP:REP 354->458|1g5hA1|8.2e-34|61.9|105/127|c.51.1.1|1/1|Class II aaRS ABD-related| OP:NHOMO 604 OP:NHOMOORG 502 OP:PATTERN 11111111122112111111111111111111111111111111111111111111111111111111 ---1111111111111111-111111111111111111111---11111111111111--111111111111111111----1-----111111111-111111111111---------------111111111111111111111-------------------------------------11111---11-11111-111111111------1111111-----------11111111111111111111----------------------------------------------------------------------1111111111111111-111111211-1-11------------1111---1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------1111111111111111111111-1111111111111111112----------111 1111111-311111111111111121111111112111111111111111111111121111111111-1111112222211111111-12112111111111222121312113221211221221112G2-2342211212212111221121322212-1131121121231111181111112321222222224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 457 STR:RPRED 99.1 SQ:SECSTR ####ccHHHHHHHHHHTTcEEETTGGGTccTTcEEEcHHHHHHHHHHHHHHHHHHTTccccEEEEccccEEETTHHHHTcHHHHcEEEEccccccccccccEEHHHHHHHHHHccccccccEEEHHHHHHHHcccccEEEEccEEEEccccccGGGEEEEccccHHHHHHTHHHHHHHHTccccEEEEEEEEEEcccccccTGGGcccEEEEEEEEEEEcGGGHHHHHHHHHHHHHHHHHHTTccGGGEEEEEccTTTccTTccEEEEEEEEETEETTEEEEEEEEEEcTTHHHHHHcccTTTTTcEEccccccEEccEEEEEEEEHHHHHHHHHHHHEEEEEcTcHHcTccEEEEEcccGGGccccEEEEEcccccHHHHHHHHHHHHHHTcccEEEcccccHHHHHHHHHHTTccEEEEEcHHHHTcTEEEEEETTTccEEEEEHHHHHHHHHHHHHHH DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHccccccccHHcccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHccccccccccccccccccccccHHHHHHHHHHHHcccHHHHcccccccccccccccccccHHHHHHHHHccccccccccEEEcccccHHHHHHHHHHHHHccccccEEEEEEEEEEEcccccccccEEEcccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEccccHHHHccccEEEEEEEccccccccEEEEEHHHccHHHHHHHHHHcccccEEEEcccccEEEEEEEEEccccHHHHHHHHHHHHHHcccccccccccccEEcccccccccEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHccccEEEEEccccccccEEEEEEcccccEEEEEHHHHHHHHHHHHccc //