[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55156.1
DDBJ      :             hypothetical protein
Swiss-Prot:UPPS2_CORGL  RecName: Full=Undecaprenyl pyrophosphate synthetase 2;         Short=UPP synthetase 2;         EC=2.5.1.31;AltName: Full=Di-trans,poly-cis-decaprenylcistransferase 2;AltName: Full=Undecaprenyl diphosphate synthase 2;         Short=UDS 2;

Homologs  Archaea  67/68 : Bacteria  871/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
c.101.1
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->243 2vg2D PDBj 6e-77 55.8 %
:RPS:PDB   14->237 2e98A PDBj 9e-72 35.3 %
:RPS:SCOP  9->236 1f75A  c.101.1.1 * 3e-61 35.6 %
:HMM:SCOP  10->237 1jp3A_ c.101.1.1 * 1.1e-82 50.9 %
:RPS:PFM   21->241 PF01255 * Prenyltransf 7e-47 41.2 %
:HMM:PFM   21->241 PF01255 * Prenyltransf 2.8e-78 45.5 220/223  
:BLT:SWISS 1->243 UPPS2_CORGL e-119 100.0 %
:PROS 187->204|PS01066|UPP_SYNTHETASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55156.1 GT:GENE BAF55156.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2378020..2378751) GB:FROM 2378020 GB:TO 2378751 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55156.1 LENGTH 243 SQ:AASEQ MSEFQVPEIPAQFLPKHIALVMDGNGRWATERGMKRTEGHKRGEAVLLDVVDACIELGVPYLSAYAFSTENWRRSTDEVRFLMGFNRDVLRRQRDDLHEKGVRVRWVGRRPRLWRSVIRELETAEELTKDNTTMTLAMCVNYGGRAEIIDAARDIARLAAEGKLRPEQITEKTFPNFLDEPDMPDVDLFLRPSGEKRTSNFLLWQSAYAEMVYQDKLFPDFTQQDLYDAVLEYAKRDRRFGSA GT:EXON 1|1-243:0| SW:ID UPPS2_CORGL SW:DE RecName: Full=Undecaprenyl pyrophosphate synthetase 2; Short=UPP synthetase 2; EC=2.5.1.31;AltName: Full=Di-trans,poly-cis-decaprenylcistransferase 2;AltName: Full=Undecaprenyl diphosphate synthase 2; Short=UDS 2; SW:GN Name=uppS2; OrderedLocusNames=Cgl2283, cg2508; SW:KW Cell cycle; Cell division; Cell shape;Cell wall biogenesis/degradation; Complete proteome;Peptidoglycan synthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->243|UPPS2_CORGL|e-119|100.0|243/243| GO:SWS:NREP 6 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 187->204|PS01066|UPP_SYNTHETASE|PDOC00817| SEG 101->115|gvrvrwvgrrprlwr| SEG 145->161|raeiidaardiarlaae| BL:PDB:NREP 1 BL:PDB:REP 2->243|2vg2D|6e-77|55.8|242/284| RP:PDB:NREP 1 RP:PDB:REP 14->237|2e98A|9e-72|35.3|224/226| RP:PFM:NREP 1 RP:PFM:REP 21->241|PF01255|7e-47|41.2|221/222|Prenyltransf| HM:PFM:NREP 1 HM:PFM:REP 21->241|PF01255|2.8e-78|45.5|220/223|Prenyltransf| GO:PFM:NREP 1 GO:PFM GO:0016765|"GO:transferase activity, transferring alkyl or aryl (other than methyl) groups"|PF01255|IPR001441| RP:SCP:NREP 1 RP:SCP:REP 9->236|1f75A|3e-61|35.6|216/217|c.101.1.1| HM:SCP:REP 10->237|1jp3A_|1.1e-82|50.9|228/228|c.101.1.1|1/1|Undecaprenyl diphosphate synthase| OP:NHOMO 1342 OP:NHOMOORG 1118 OP:PATTERN 11111111111111111111111112212111111111111111111111222111111111111-11 1221222222221222222-22223222222321112222222222222222222222222222222233211111111111111111111111111--11111111111111111111111111111111111111111111111221111111111111111111222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111211111111111211111111111112111111-----112221111122111111111111-222222211111111111111111111111111111111111111111111111111------111111111111111111111111111111111112111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111121111-1111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------1------1111111111111 ----111-21-1-1111111111112111111121211111111111111111111-1111121222211222222222221221111-11-12131111111111-1412111111-11-11154131AG2-311-11-2-121111111111111122111111-121-11112212F2222133261872232222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHcTTccccEEEEEEccHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEccccGGGccHHHHHHHHHHHHHHTTTHHHHHHHTTcEEEEEcccTTccHHHHHHHHHHHHHHTTccccEEEEEccccHHHHHHHHHHHHHHHHHHTcccGGGccHHHHHTTcTTTTcccccEEEEcccccccTTcccGGGTTcEEEEccccGGGccHHHHHHHHHHHHHHcHHcTcc DISOP:02AL 1-3,6-6,242-244| PSIPRED cHHHHHHHccccccccEEEEEEccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcHHHccHHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHccccccccccEEEEccccccccccHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHHcccccc //