[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55164.1
DDBJ      :             hypothetical protein
Swiss-Prot:DNAJ1_CORGL  RecName: Full=Chaperone protein dnaJ 1;

Homologs  Archaea  26/68 : Bacteria  910/915 : Eukaryota  197/199 : Viruses  2/175   --->[See Alignment]
a.2.3a.4.5b.4.1g.54.1
:382 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->68 2ctwA PDBj 4e-17 60.3 %
:BLT:PDB   115->330 1nltA PDBj 8e-18 30.5 %
:RPS:PDB   4->69 2cugA PDBj 4e-19 45.5 %
:RPS:PDB   134->377 1cmwA PDBj 6e-36 12.8 %
:RPS:SCOP  3->68 2nraC1  a.4.5.10 * 4e-18 9.4 %
:RPS:SCOP  134->214 1exkA  g.54.1.1 * 3e-16 41.6 %
:RPS:SCOP  188->260 1nltA1  b.4.1.1 * 1e-07 13.7 %
:RPS:SCOP  263->350 1c3gA2  b.4.1.1 * 3e-21 25.0 %
:HMM:SCOP  2->112 1gh6A_ a.2.3.1 * 1.2e-27 50.0 %
:HMM:SCOP  118->261 1c3gA1 b.4.1.1 * 3.4e-18 35.0 %
:HMM:SCOP  262->350 1c3gA2 b.4.1.1 * 6.1e-20 36.0 %
:RPS:PFM   4->61 PF00226 * DnaJ 7e-19 70.7 %
:RPS:PFM   134->211 PF00684 * DnaJ_CXXCXGXG 2e-15 44.9 %
:RPS:PFM   250->341 PF01556 * DnaJ_C 1e-19 42.4 %
:HMM:PFM   218->257 PF01556 * DnaJ_C 4.4e-05 32.5 40/101  
:HMM:PFM   249->347 PF01556 * DnaJ_C 2.1e-29 34.3 99/101  
:HMM:PFM   4->65 PF00226 * DnaJ 1.1e-28 62.9 62/64  
:HMM:PFM   134->211 PF00684 * DnaJ_CXXCXGXG 3.5e-22 39.7 78/79  
:BLT:SWISS 1->382 DNAJ1_CORGL 0.0 97.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55164.1 GT:GENE BAF55164.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2384348..2385496) GB:FROM 2384348 GB:TO 2385496 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55164.1 LENGTH 382 SQ:AASEQ MARDYYGILGVDRNATESEIKKAYRKLARKYHPDVNPGEEAAEKFREASVAHEVLTDPDKRRIVDMGGDPMEQGGGAGAGGFGGGFGSSGGLGDIFDAFFGGGAGGSRGPRSRVQPGSDTLWRTSITLEEAYKGAKKDLTLDTAVLCTKCHGSGSASDKKPVTCGTCNGAGEIQEVQRSFLGNVMTSRPCHTCDGTGEIIPDPCTECAGDGRVRARRDIVASIPAGIQSGMRIRMAGQGEVGAGGGPAGDLYIEVMVRPHAIFTRDGDDLHASIKVPMFDAALGTELDVESLTGEEVKITIPAGTQPNDVITLDGEGMSKLRAEGHGNLMAHVDLFVPTDLDDRTRELLEEIRNHRSDNASVHREGGEESGFFDKLRNKFRK GT:EXON 1|1-382:0| SW:ID DNAJ1_CORGL SW:DE RecName: Full=Chaperone protein dnaJ 1; SW:GN Name=dnaJ1; OrderedLocusNames=Cgl2290, cg2515; SW:KW Chaperone; Complete proteome; Cytoplasm; DNA replication;Metal-binding; Repeat; Stress response; Zinc; Zinc-finger. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->382|DNAJ1_CORGL|0.0|97.6|382/382| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006950|"GO:response to stress"|Stress response| SEG 74->106|gggagaggfgggfgssgglgdifdaffgggagg| SEG 236->249|agqgevgagggpag| BL:PDB:NREP 2 BL:PDB:REP 6->68|2ctwA|4e-17|60.3|63/109| BL:PDB:REP 115->330|1nltA|8e-18|30.5|213/228| RP:PDB:NREP 2 RP:PDB:REP 4->69|2cugA|4e-19|45.5|66/88| RP:PDB:REP 134->377|1cmwA|6e-36|12.8|226/817| RP:PFM:NREP 3 RP:PFM:REP 4->61|PF00226|7e-19|70.7|58/63|DnaJ| RP:PFM:REP 134->211|PF00684|2e-15|44.9|78/78|DnaJ_CXXCXGXG| RP:PFM:REP 250->341|PF01556|1e-19|42.4|92/95|DnaJ_C| HM:PFM:NREP 4 HM:PFM:REP 218->257|PF01556|4.4e-05|32.5|40/101|DnaJ_C| HM:PFM:REP 249->347|PF01556|2.1e-29|34.3|99/101|DnaJ_C| HM:PFM:REP 4->65|PF00226|1.1e-28|62.9|62/64|DnaJ| HM:PFM:REP 134->211|PF00684|3.5e-22|39.7|78/79|DnaJ_CXXCXGXG| GO:PFM:NREP 6 GO:PFM GO:0031072|"GO:heat shock protein binding"|PF00226|IPR001623| GO:PFM GO:0006457|"GO:protein folding"|PF00684|IPR001305| GO:PFM GO:0031072|"GO:heat shock protein binding"|PF00684|IPR001305| GO:PFM GO:0051082|"GO:unfolded protein binding"|PF00684|IPR001305| GO:PFM GO:0006457|"GO:protein folding"|PF01556|IPR002939| GO:PFM GO:0051082|"GO:unfolded protein binding"|PF01556|IPR002939| RP:SCP:NREP 4 RP:SCP:REP 3->68|2nraC1|4e-18|9.4|64/135|a.4.5.10| RP:SCP:REP 134->214|1exkA|3e-16|41.6|77/79|g.54.1.1| RP:SCP:REP 188->260|1nltA1|1e-07|13.7|65/74|b.4.1.1| RP:SCP:REP 263->350|1c3gA2|3e-21|25.0|88/90|b.4.1.1| HM:SCP:REP 2->112|1gh6A_|1.2e-27|50.0|106/0|a.2.3.1|1/1|Chaperone J-domain| HM:SCP:REP 118->261|1c3gA1|3.4e-18|35.0|80/80|b.4.1.1|1/2|HSP40/DnaJ peptide-binding domain| HM:SCP:REP 262->350|1c3gA2|6.1e-20|36.0|89/90|b.4.1.1|2/2|HSP40/DnaJ peptide-binding domain| OP:NHOMO 4674 OP:NHOMOORG 1135 OP:PATTERN ------------------------21111111111--------2212111211--------111--21 2222322222222222222-22222222222222222253233322222222222232222222222322222222223222222222222212111112321223323211111111111111111111111121333332222243533344333223223333344541212211212212212211221111111111111111111111111111121221111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111121111111111211221131222212213111111113222222422221223232212222222222222222124223232222131112223333222222112111111122222222222222331111111111111111111111111111212233221222211112111111122111111112131222221211222223213342111112222222222324232232222322222222323222222223562212222222222222222222222222211212122311111122111111111111-1321211111121111112222222222-22222222222222222222221111222222222222222222222222211211111111111111122222222222222111121111-11111222221222221111122221222213232222222223222111111111112222222222222211221111111111111121111111-11111421111112111111111111111221 D657EDD-gHE37AF8CBCADCCDBBBAA9BBB9B9BBAB7BBBBBCBBBAABAA988AAABAA9878389A99B695678B9B9A99-9FAC8A8956B889IFI2BT9XahVRVLEEBBFMDdRASAy*Q1SLUBE9DW8IVMAEHEBOCDaDMLNICFGFHDDBdHMUGELC9JFD*9C8DCbUVlAjNFBKJMIO --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1- STR:NPRED 374 STR:RPRED 97.9 SQ:SECSTR ccccHHHHHTccTTccHHHHHHHHHHHHHHccTTTcccTTHHHHHHHHHHHHHHHHcHHHHHHHHHHTTHHHHTTcEEEEEETTccEEEcEEEEcTTccEEEc###cccccccHHHcccccccccccccccccccccccccccccHHHHTTTTTTTTTTTccHHHHHHHHHHHEEEEHHHHHHHTccTTTcccTTTcccccEEEcccccccccEEEcccGGGccTTcHHHHHHHHTccccTTEEEEEEEETTHHHHHHHHHHTcHHHHHHHHHTccHHHHHHHHHTccTTcccTTHHTccGGGccHHTcEHHHHHHHHHHHTTccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccccccc##### DISOP:02AL 1-1,68-85,103-119,148-167,176-177,179-184,351-374| PSIPRED ccccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccEEEEEEccHHHHccccEEEEEEccccccccccccccccccccEEcccccccccEEEEEEccccEEEEEEEccccccccEEEEEEccccccccEEEEEEEEEEEEccccccccEEEEcccccccccccccccEEEEEEEEccccEEEEccEEEEEEEccHHHHccccEEEEEcccccEEEEEEccccccccEEEEcccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHc //