[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55169.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->18 PF10708 * DUF2510 0.00078 55.6 9/36  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55169.1 GT:GENE BAF55169.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2389455..2389835) GB:FROM 2389455 GB:TO 2389835 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55169.1 LENGTH 126 SQ:AASEQ MSNTETQFDWDGSTWTRTEVGEAPTRFAVGVMEDFAYIAATGTDGDEEFFTLGSNPGLTFGDPEWLFAQDNPQYVVECIGQQGTEPAALKVVDKYLSRLSDEESRGEPTRILNELVSAMELPALPW GT:EXON 1|1-126:0| HM:PFM:NREP 1 HM:PFM:REP 10->18|PF10708|0.00078|55.6|9/36|DUF2510| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,101-106,108-108| PSIPRED ccccEEEEEEcccEEEEHHcccccHHHHHHHHHHHHHHHcccccccHHHEEEcccccccccccccEEEcccHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHcccccccc //