[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55173.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:46 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->43 PF11298 * DUF3099 7.2e-05 30.6 36/73  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55173.1 GT:GENE BAF55173.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2396088..2396228) GB:FROM 2396088 GB:TO 2396228 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55173.1 LENGTH 46 SQ:AASEQ MANPEELRKRDQELPKRKRKYPQSRVTQALVVLLVIVVIAWLVSLI GT:EXON 1|1-46:0| TM:NTM 1 TM:REGION 25->46| SEG 30->45|lvvllvivviawlvsl| HM:PFM:NREP 1 HM:PFM:REP 8->43|PF11298|7.2e-05|30.6|36/73|DUF3099| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-23| PSIPRED cccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHc //